DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and AT1G74240

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_177564.2 Gene:AT1G74240 / 843764 AraportID:AT1G74240 Length:364 Species:Arabidopsis thaliana

Alignment Length:316 Identity:95/317 (30%)
Similarity:143/317 (45%) Gaps:57/317 (18%)


  Fly    13 SVAIKMQEPVNKLKFF--HALVAGGVAGMVVDIALFPIDTVKTRLQSEL---------------- 59
            ||.||....    :||  ...:.||:||...:..:.|:||:||||||::                
plant    20 SVEIKATHD----QFFVWREFLWGGIAGAFGEGMMHPVDTLKTRLQSQIIMNATQRQKSILQMLR 80

  Fly    60 GFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLAC 124
            ..|...|.:|.|:|:||...||..|.|.:|...|..|:::.....:....:.|..|.:..:.|..
plant    81 TVWVGDGLKGFYRGIAPGVTGSLATGATYFGFIESTKKWIEESHPSLAGHWAHFIAGAVGDTLGS 145

  Fly   125 LIRVPVEIAKQRSQTLQGNKQSGLQILLR------------------------AYRTEGLKRGLY 165
            .|.||.|:.|||.| :||...|....:.|                        .::.:|.| |||
plant   146 FIYVPCEVIKQRMQ-IQGTSSSWSSYISRNSVPVQPRGDMYGYYTGMFQAGCSIWKEQGPK-GLY 208

  Fly   166 RGFGSTIMREIPFSLIQFPLWEYFK------LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPL 224
            .|:.||:.|::||:.:....:|..|      .:..|..|.:|:...:.| |.:|||:||.|||||
plant   209 AGYWSTLARDVPFAGLMVVFYEGLKDLTDQGKKKFPQYGVNSSIEGLVL-GGLAGGLSAYLTTPL 272

  Fly   225 DVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFF 280
            ||||||:.:  :.|..:.:.....:..|:.:.|..|.|.|.||||:|.....|..|
plant   273 DVVKTRLQV--QGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWYLPASALTF 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/94 (31%)
PTZ00168 25..281 CDD:185494 91/305 (30%)
Mito_carr 199..291 CDD:278578 32/83 (39%)
AT1G74240NP_177564.2 Mito_carr 28..120 CDD:278578 29/96 (30%)
PTZ00168 34..332 CDD:185494 89/299 (30%)
Mito_carr 131..235 CDD:278578 28/106 (26%)
Mito_carr 265..339 CDD:278578 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.