DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SAMC2

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_564436.4 Gene:SAMC2 / 840304 AraportID:AT1G34065 Length:345 Species:Arabidopsis thaliana

Alignment Length:290 Identity:106/291 (36%)
Similarity:162/291 (56%) Gaps:13/291 (4%)


  Fly     9 SAAGSVAIKMQEPVNKLK-FFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGG---FRG 69
            ::..::.:|..:|.:.|: .:.:|:.||:||:||:.||:||||:|||:|..    |.||   ::|
plant    59 NSCAAICVKQDDPCHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRIQVA----RDGGKIIWKG 119

  Fly    70 IYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAK 134
            :|.||.....|..|.:||||..||..||.|..|.....|...|:||.:....::.::|||.|:.|
plant   120 LYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPDNLSAVAHLAAGALGGAVSSIVRVPTEVVK 184

  Fly   135 QRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGF 199
            ||.||  |...|....:......||. .|:|.|:||.::|::||..:||.::|..::.:......
plant   185 QRMQT--GQFVSAPDAVRLIIAKEGF-GGMYAGYGSFLLRDLPFDALQFCVYEQLRIGYKLAARR 246

  Fly   200 DSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAG 264
            |......|:.||.||.::..|||||||:|||:|:  :.|..:.:.....:..|..|.|.|.|:.|
plant   247 DLNDPENAMIGAFAGAVTGVLTTPLDVIKTRLMV--QGSGTQYKGVSDCIKTIIREEGSSALWKG 309

  Fly   265 FVPRVLWITLGGAFFFGFYDLTTRILGATS 294
            ..||||||.:||:.|||..:.|.:||...|
plant   310 MGPRVLWIGIGGSIFFGVLEKTKQILSERS 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 35/80 (44%)
PTZ00168 25..281 CDD:185494 99/260 (38%)
Mito_carr 199..291 CDD:278578 38/92 (41%)
SAMC2NP_564436.4 Mito_carr 78..153 CDD:278578 36/79 (46%)
PTZ00168 79..328 CDD:185494 99/258 (38%)
Mito_carr 155..237 CDD:278578 28/85 (33%)
Mito_carr 247..339 CDD:278578 38/94 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1504
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125056
orthoMCL 1 0.900 OOG5_128405
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.