DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Mfl1

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_199028.1 Gene:Mfl1 / 834218 AraportID:AT5G42130 Length:412 Species:Arabidopsis thaliana

Alignment Length:307 Identity:93/308 (30%)
Similarity:150/308 (49%) Gaps:45/308 (15%)


  Fly    17 KMQEPVNKLKFFHALV----AGGVAGMVVDIALFPIDTVKTRLQSE-------------LGFWRA 64
            ::|..:.:|..:...:    |||:||....:.|.|:|.:||:||::             :..::|
plant   100 RIQTLIKQLSVWERAIIGAGAGGLAGAFTYVTLLPLDAIKTKLQTKGASQVYSNTFDAIVKTFQA 164

  Fly    65 GGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHM--AAASAAEVLACLIR 127
            .|..|.|.|::....||..::|::|.|.|.||..||   :..|.|.|.:  .|.:...:::..|.
plant   165 KGILGFYSGVSAVIVGSTFSSAVYFGTCEFGKSLLS---KFPDFPTVLIPPTAGAMGNIISSAIM 226

  Fly   128 VPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFK-- 190
            ||.|:..||.|.  |......|:||:....:|: .|||.|:.:|::|.:|..::.:..:||.|  
plant   227 VPKELITQRMQA--GASGRSYQVLLKILEKDGI-LGLYAGYSATLLRNLPAGVLSYSSFEYLKAA 288

  Fly   191 -LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIML-AERESLNRRRSA-------- 245
             |:.|..:..:  |.....|||:||.|||.:||||||||||:|. ...|::::...|        
plant   289 VLEKTKQSHLE--PLQSVCCGALAGAISASITTPLDVVKTRLMTQIHVEAVDKLGGAMYTGVAGT 351

  Fly   246 -RRILHGIYLERGFSGLFAGFVPRVLWITLGGAF-FFGFYDLTTRIL 290
             ::||    .|.|:.|...|..|||:......|. :|.|......||
plant   352 VKQIL----TEEGWVGFTRGMGPRVVHSACFSAIGYFAFETARLTIL 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 26/93 (28%)
PTZ00168 25..281 CDD:185494 89/289 (31%)
Mito_carr 199..291 CDD:278578 36/104 (35%)
Mfl1NP_199028.1 Mito_carr <134..201 CDD:278578 21/70 (30%)
Mito_carr 214..292 CDD:278578 24/81 (30%)
Mito_carr 296..397 CDD:278578 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.