DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and mSFC1

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_195754.1 Gene:mSFC1 / 831479 AraportID:AT5G01340 Length:309 Species:Arabidopsis thaliana

Alignment Length:299 Identity:88/300 (29%)
Similarity:115/300 (38%) Gaps:63/300 (21%)


  Fly    32 VAGGVAGMVVDIALFPIDTVKTRLQ-SELGFW-----------RAGGFRGIYKGLAPAAA----- 79
            |:|.:.|:|....|.|||.:||||| ..:|.:           |..|.|.::|||.|.|.     
plant    18 VSGSLGGVVEACCLQPIDVIKTRLQLDRVGAYKGIAHCGSKVVRTEGVRALWKGLTPFATHLTLK 82

  Fly    80 -----GSAPTAALFFCTYECGK-----QFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAK 134
                 ||.......|...|.||     :|||..            .|...|.||  |..|.|:.|
plant    83 YTLRMGSNAMFQTAFKDSETGKVSNRGRFLSGF------------GAGVLEALA--IVTPFEVVK 133

  Fly   135 QRSQTLQGNKQSGLQILLRAY-----------RTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEY 188
            .|.|     :|.||...|..|           |.|.: .||:.|...|:||......:.|.....
plant   134 IRLQ-----QQKGLSPELFKYKGPIHCARTIVREESI-LGLWSGAAPTVMRNGTNQAVMFTAKNA 192

  Fly   189 FK-LQWTPLTGFDS--TPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLN--RRRSARRI 248
            |. |.|....|...  .|:...:.|.:||......|.|.||||||:|...|:|..  |.:.....
plant   193 FDILLWNKHEGDGKILQPWQSMISGFLAGTAGPFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHA 257

  Fly   249 LHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTT 287
            :..||.|.|...|:.|.:||::.|..|.|..:...|..|
plant   258 IRTIYAEEGLVALWRGLLPRLMRIPPGQAIMWAVADQVT 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/94 (31%)
PTZ00168 25..281 CDD:185494 86/292 (29%)
Mito_carr 199..291 CDD:278578 29/94 (31%)
mSFC1NP_195754.1 Mito_carr 9..>74 CDD:278578 20/56 (36%)
Mito_carr 103..200 CDD:278578 32/117 (27%)
Mito_carr 210..295 CDD:278578 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.