DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SAMTL

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_850252.1 Gene:SAMTL / 818153 AraportID:AT2G35800 Length:823 Species:Arabidopsis thaliana

Alignment Length:266 Identity:84/267 (31%)
Similarity:128/267 (48%) Gaps:13/267 (5%)


  Fly    32 VAGGVAGMVVDIALFPIDTVKTRLQ-SELGFWRA------GGFRGIYKGLAPAAAGSAPTAALFF 89
            :|||:|..:....:.||||:|||:| |.|.|...      .|.||:|:|..||..|...:..|..
plant   546 LAGGLASALSTSLMHPIDTIKTRVQASTLSFPEVIAKLPEIGVRGVYRGSIPAILGQFSSHGLRT 610

  Fly    90 CTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRA 154
            ..:|..|..|.:.........|...|:..:.:|...:|:|.|:.|||.|....|...  :.::..
plant   611 GIFEASKLVLINFAPNLPEIQVQSIASFCSTLLGTAVRIPCEVLKQRLQAGMFNNVG--EAIVGT 673

  Fly   155 YRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAG 219
            ::.:| ..|.:||.|:|:.||:|..::...|:...|.......|.:...:.....|||:|||:|.
plant   674 WKQDG-PSGFFRGTGATLCREVPLYVVGMGLYAESKKMVAQALGRELEAWETIAVGAVSGGIAAV 737

  Fly   220 LTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284
            :|||.||:|||:|.|   :..|..|...::..|....|..|||.|.|||..|:...||..|..|:
plant   738 VTTPFDVMKTRMMTA---TPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYE 799

  Fly   285 LTTRIL 290
            |..:.:
plant   800 LAKKAM 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 26/74 (35%)
PTZ00168 25..281 CDD:185494 82/256 (32%)
Mito_carr 199..291 CDD:278578 34/93 (37%)
SAMTLNP_850252.1 EF-hand_7 <339..403 CDD:290234
EFh <339..399 CDD:298682
Mito_carr 541..622 CDD:278578 27/76 (36%)
PTZ00168 542..797 CDD:185494 82/257 (32%)
Mito_carr 635..710 CDD:278578 21/78 (27%)
Mito_carr 718..808 CDD:278578 34/92 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.