DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and AT2G26360

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_180204.2 Gene:AT2G26360 / 817176 AraportID:AT2G26360 Length:387 Species:Arabidopsis thaliana

Alignment Length:313 Identity:99/314 (32%)
Similarity:144/314 (46%) Gaps:33/314 (11%)


  Fly     3 AELG-LESAAGSVAIKMQEPVNKLKFF-----------HAL---VAGGVAGMVVDIALFPIDTVK 52
            |::| ..|.:..:|..:.|.|.|.|.|           |.|   :|||::.......:.|:||||
plant    72 AKVGNFTSRSNEIAPLINEAVAKGKNFDTGTRVGLDVGHLLKSALAGGISCAFSAFLMHPVDTVK 136

  Fly    53 TRLQSE--LGFWR------AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSP 109
            |::|:.  |.|..      ..|.||:|||..||..|...:..|....||..|..|..|..|....
plant   137 TQVQASTTLSFLEILSKIPEIGARGLYKGSIPAVVGQFASHGLRTSIYEASKLALPLVAPTLLDI 201

  Fly   110 YVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGL-QILLRAYRTEGLKRGLYRGFGSTIM 173
            .|...|:....||...:|:|.|:.|||   ||.|:...: :..:..:..|||| ||:||.|.|::
plant   202 QVQSIASFIGTVLGTTLRIPCEVLKQR---LQANQFDNIVEATVSTWHQEGLK-GLFRGTGVTLL 262

  Fly   174 REIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLA-ERE 237
            ||:||.:....|:...|.......|.:..|:.....||::||.:|.||||.||:|||:|.| :..
plant   263 REVPFYVAGMGLYNQSKKVVERQLGRELEPWEAIAVGALSGGFTAVLTTPFDVIKTRMMTAPQGV 327

  Fly   238 SLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRIL 290
            .|:...:|    :.|....|....:.|.|||..|....||.....|:|..:.:
plant   328 ELSMLMAA----YSILTHEGPLAFYKGAVPRFFWTAPLGALNLAGYELLQKAM 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 30/98 (31%)
PTZ00168 25..281 CDD:185494 90/280 (32%)
Mito_carr 199..291 CDD:278578 30/94 (32%)
AT2G26360NP_180204.2 Mito_carr 110..191 CDD:278578 27/81 (33%)
PTZ00169 116..376 CDD:240302 88/268 (33%)
Mito_carr 206..281 CDD:278578 28/79 (35%)
Mito_carr 289..380 CDD:278578 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.