DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and slc25a26

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001004820.1 Gene:slc25a26 / 448074 XenbaseID:XB-GENE-991471 Length:269 Species:Xenopus tropicalis

Alignment Length:263 Identity:140/264 (53%)
Similarity:174/264 (66%) Gaps:4/264 (2%)


  Fly    22 VNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAGSAPTAA 86
            :.:.:|..:|:|||.|||.||:.|||:||:||||||.|||.::|||||||.|:...|.||.|.||
 Frog     1 MERREFCASLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAA 65

  Fly    87 LFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQIL 151
            .||.|||..||.|.| ..:..||.:||||||..||:|||||||.|:.|||:|.  ....:..|:|
 Frog    66 AFFVTYESAKQLLRS-DSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQV--SPSSTTYQML 127

  Fly   152 LRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGI 216
            ....|.||:| |||||:.||::|||||||:||||||..|..|:...|.....:..|:|||.|||.
 Frog   128 SATLRQEGIK-GLYRGYKSTVLREIPFSLVQFPLWESLKDLWSWKQGRAVDSWQSAVCGAFAGGF 191

  Fly   217 SAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFG 281
            :|.|||||||.|||||||:..|.....:....||.|:..:|..|||||.:||:..|:|||..|.|
 Frog   192 AAALTTPLDVAKTRIMLAKAGSGVASGNVLFALHEIWRTQGIMGLFAGVIPRMTAISLGGFIFLG 256

  Fly   282 FYD 284
            .||
 Frog   257 AYD 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 45/76 (59%)
PTZ00168 25..281 CDD:185494 137/256 (54%)
Mito_carr 199..291 CDD:278578 42/87 (48%)
slc25a26NP_001004820.1 Solcar 1 4..77 45/73 (62%)
Mito_carr 5..257 CDD:332982 138/256 (54%)
Solcar 2 85..167 49/85 (58%)
Solcar 3 176..264 42/85 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C178727565
eggNOG 1 0.900 E1_KOG0768
Hieranoid 1 1.000
Homologene 1 1.000 H6834
Inparanoid 1 1.050 254 1.000 Inparanoid score I2975
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003484
OrthoInspector 1 1.000 T601499
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1767
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.