DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG7943

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:259 Identity:55/259 - (21%)
Similarity:98/259 - (37%) Gaps:35/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELGLESAAGSVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE-LGFWRAGGF 67
            |......|..|.|.:..|:.|: .|..::.|           .||.:...:|:.| |||      
  Fly    56 EFACGCGAAFVNIAVTYPIYKM-IFRQMLHG-----------VPITSAFAQLRHEGLGF------ 102

  Fly    68 RGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKD---SPYVHMAAASAAEVLACLIRVP 129
              :|:|:.|..|....:.::.|..::..:::|....:..|   .....:.|.||..:|....||.
  Fly   103 --LYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAESILLPFERVQ 165

  Fly   130 VEIAKQRSQTLQGNKQSGLQILL--RAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQ 192
            ..:|..:......|.|:..:.::  ..||.      ||||......|....:.:.|.|.|...::
  Fly   166 TLLADSKFHQHFSNTQNAFRYVVSHHGYRE------LYRGLEPVFWRNGLSNALFFVLREEASVR 224

  Fly   193 WTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLER 256
            ........:......:.|||.|...:.:..||:|:|..:   :.|...|...:.:....||:||
  Fly   225 LPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSL---QSEMGQRSEGSWQACKRIYVER 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 15/76 (20%)
PTZ00168 25..281 CDD:185494 49/238 (21%)
Mito_carr 199..291 CDD:278578 14/58 (24%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 21/99 (21%)
Mito_carr 141..229 CDD:278578 19/93 (20%)
Mito_carr 235..322 CDD:278578 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.