DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and mfrn

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster

Alignment Length:284 Identity:81/285 (28%)
Similarity:130/285 (46%) Gaps:51/285 (18%)


  Fly    31 LVAGGVAGMVVDIALFPIDTVKTRLQS--------------ELGFWRAGGFRGIYKGLAPAAAGS 81
            :.||.:||::..:.::|:|:||||:||              .....|.|..|.| :|.:....|:
  Fly    18 MTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPI-RGASAVVLGA 81

  Fly    82 APTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQS 146
            .|..:|:|..||..|:..:..|..::..||  .:.:.|.::...|..|.::.|||.|.......|
  Fly    82 GPAHSLYFAAYEMTKELTAKFTSVRNLNYV--ISGAVATLIHDAISSPTDVIKQRMQMYNSPYTS 144

  Fly   147 GLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYF------KLQWTPLTGFDSTPFS 205
            .:..:...|:.||.| ..||.:|:.::..:|:..|.|..:|:|      :.::.|       |..
  Fly   145 VVSCVRDIYKREGFK-AFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNP-------PVH 201

  Fly   206 VALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRR--RSARRILHGIYLERGFSGLFAGFVPR 268
            :| .||.||..:|.:||||||:|| ::..:...|.|.  .::|:|.|    ..|..|.|.|...|
  Fly   202 MA-AGAAAGACAAAVTTPLDVIKT-LLNTQETGLTRGMIEASRKIYH----MAGPLGFFRGTTAR 260

  Fly   269 VL---------WITLGGAFFFGFY 283
            ||         |.|..   ||.||
  Fly   261 VLYSMPATAICWSTYE---FFKFY 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 24/82 (29%)
PTZ00168 25..281 CDD:185494 79/281 (28%)
Mito_carr 199..291 CDD:278578 33/97 (34%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 24/81 (30%)
PTZ00168 17..280 CDD:185494 79/282 (28%)
Mito_carr 107..190 CDD:278578 22/86 (26%)
Mito_carr <215..282 CDD:278578 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2020425
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.