DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and DPCoAC

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster

Alignment Length:312 Identity:73/313 (23%)
Similarity:136/313 (43%) Gaps:47/313 (15%)


  Fly     6 GLESAAGSVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQ--SELGF-WRAG-- 65
            |:.....:....|::.::::..  :|::|..||.:....:.|:|..|...|  :::.| :||.  
  Fly    53 GVVLVPATTVTPMRQKIDQVVI--SLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLR 115

  Fly    66 ---------GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFL---SSVTQTKDSPYVHMAAASA 118
                     |...:::|.:...|...|.||:.|..:|..::.|   ...|.||...::   |.|.
  Fly   116 YLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFL---AGSL 177

  Fly   119 AEVLACLIRVPVEIAKQRS---------QTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMR 174
            |.:.:..:..|:::|:.|.         :||:       |:..:.:..|| .|.|:||:.:|::.
  Fly   178 AGITSQSLTYPLDLARARMAVTDRYTGYRTLR-------QVFTKIWVEEG-PRTLFRGYWATVLG 234

  Fly   175 EIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALC-GAVAGGISAGLTTPLDVVKTRI--MLAER 236
            .||::...|..:|..|.::..:.|.:.....|:|. ||.||......:.|||:|:.|:  |....
  Fly   235 VIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT 299

  Fly   237 ESLNRRRSARRILHGIYLERGF-SGLFAGFVPRVLWI--TLGGAFFFGFYDL 285
            ...:|..:....|..||.|.|. :|.:.|.  .:.||  .:.....|..|||
  Fly   300 AGGDRYPTILETLVKIYREEGVKNGFYKGL--SMNWIKGPIAVGISFSTYDL 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/90 (21%)
PTZ00168 25..281 CDD:185494 68/288 (24%)
Mito_carr 199..291 CDD:278578 26/94 (28%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 20/89 (22%)
Mito_carr 169..251 CDD:278578 21/93 (23%)
Mito_carr 279..356 CDD:278578 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2011726
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.