DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Dic2

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_732512.1 Gene:Dic2 / 42423 FlyBaseID:FBgn0038797 Length:304 Species:Drosophila melanogaster

Alignment Length:174 Identity:42/175 (24%)
Similarity:77/175 (44%) Gaps:20/175 (11%)


  Fly   119 AEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQF 183
            |..:|.::..|:::.|...|| |..|.|..|...:..:.:| ...:|.|..::::|:..::|.:|
  Fly    25 ASSMAAMVTHPIDLIKVLIQT-QAEKLSVFQTTRKIVKEQG-PLAMYNGISASMLRQYTYTLARF 87

  Fly   184 PLWEYFKLQWTPLTGFDSTPFSVALC-GAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARR 247
            .::.      ......|::..:...| .|:||||...:..|.|::..|:....:....:||:.:.
  Fly    88 GIYS------VGSGAMDTSTMAGKTCLAAIAGGIGGFVGAPADLINVRLQNDVKLPPEKRRNYKH 146

  Fly   248 ILHG---IYLERGFSGLFAGFVPRVLWITLGGAFF----FGFYD 284
            .:.|   |..|.|:..||.|    ...|.|.|||.    ..||:
  Fly   147 AIDGLVRITREEGWKNLFNG----SSMIALRGAFMTVGQIAFYE 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578
PTZ00168 25..281 CDD:185494 40/170 (24%)
Mito_carr 199..291 CDD:278578 26/95 (27%)
Dic2NP_732512.1 Mito_carr 22..90 CDD:278578 16/67 (24%)
Mito_carr 98..194 CDD:278578 26/94 (28%)
Mito_carr 198..285 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2024358
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.