DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Tpc1

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster

Alignment Length:342 Identity:79/343 (23%)
Similarity:130/343 (38%) Gaps:75/343 (22%)


  Fly     1 MAAELGLESAAGSVAIKMQEPVNKLKF-----FHALVAGGVAGMVVDIALFPIDTVKTRLQSE-- 58
            ||...|..|.|.:..    .||.:.|.     .|.::|||::..:......|:|.:|.|.|.:  
  Fly     1 MAVTTGSTSEATTTT----TPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVE 61

  Fly    59 -LG------------------------FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQF 98
             ||                        .:|..|....:||..||...|.......|.|||.....
  Fly    62 PLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLM 126

  Fly    99 LSSVTQTKDSPYV-HMAAASAAEVLACLIRVPVEIAKQR--SQTLQGNKQSGLQILLRAYRTEGL 160
            ....:...|..:: :....:||...|.:|..|:::.:.|  :|......::..:.:....|.|| 
  Fly   127 AKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVSAIVRQEG- 190

  Fly   161 KRGLYRGFGSTIMREIPFSLIQFPLWEYFK------LQ---------WTPLTGFDSTPFSVALCG 210
            .||:|||..|.:::..|.....|..:..|.      |:         || |.|.          |
  Fly   191 PRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWT-LLGL----------G 244

  Fly   211 AVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRI-LHGIY-------LERGFSGLFAGFVP 267
            |.:|.:|..:..|.|::|.|:.:...|| ||:...:.: .||::       .:.|..||:.|..|
  Fly   245 ASSGMLSKTIVYPFDLIKKRLQIQGFES-NRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAP 308

  Fly   268 RVLWITLGGAFFFGFYD 284
            .:|..::..|.:|..||
  Fly   309 TLLKSSMTTALYFSIYD 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 23/108 (21%)
PTZ00168 25..281 CDD:185494 70/314 (22%)
Mito_carr 199..291 CDD:278578 24/95 (25%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/94 (23%)
PTZ00169 33..329 CDD:240302 70/307 (23%)
Mito_carr 153..222 CDD:278578 16/70 (23%)
Mito_carr 233..328 CDD:278578 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2028143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.