DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG6893

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_649053.2 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:250 Species:Drosophila melanogaster

Alignment Length:138 Identity:39/139 (28%)
Similarity:63/139 (45%) Gaps:17/139 (12%)


  Fly   130 VEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWT 194
            |.|.|.|...      |.||   :|.||.|. ..||.|..:.::|::.::.::|.|:|..|....
  Fly     2 VVIKKDRGMA------SNLQ---QAIRTHGF-ISLYDGLSAQLLRQLTYTSMRFHLYEMGKEHLD 56

  Fly   195 PLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIY---LER 256
            ...|........||.|.|||.:.    ||::::.||:.:........|.:.|.:..|:|   .|.
  Fly    57 DPAGLLDKVLVAALAGCVAGVVG----TPMELINTRMQVNRALPKETRWNYRNVFDGLYRVTREE 117

  Fly   257 GFSGLFAG 264
            ||:.|::|
  Fly   118 GFTKLYSG 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578
PTZ00168 25..281 CDD:185494 39/139 (28%)
Mito_carr 199..291 CDD:278578 19/70 (27%)
CG6893NP_649053.2 Mito_carr <5..55 CDD:278578 17/60 (28%)
Mito_carr 57..151 CDD:278578 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2024405
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.