DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Mpcp2

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster

Alignment Length:318 Identity:78/319 (24%)
Similarity:134/319 (42%) Gaps:48/319 (15%)


  Fly     6 GLESAAGSVAIKMQE---PVNKLKFFHALVAGGVAGM-VVDIALFPIDTVKTRLQSELGFWR--- 63
            |.:.||.:..:..|:   .....|:|.....||:... .....:.|:|.||.|||.:...::   
  Fly    37 GRQIAAAATPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLV 101

  Fly    64 --------AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPY-----VHMAA 115
                    ..|.||:.||..|...|.:......|..||..|...:.:. .:::.|     :::||
  Fly   102 HGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEII-GEENAYLYRTSLYLAA 165

  Fly   116 ASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSL 180
            :::||..|.:...|.|.||.:.||:.|...:..:.:.:..:.||: ...|:|.....||:||:::
  Fly   166 SASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGV-NAFYKGLVPLWMRQIPYTM 229

  Fly   181 IQFP--------LWEYFKLQWTPLTGFDSTPFSVAL----CGAVAGGISAGLTTPLDVVKTRIML 233
            ::|.        |::|.    .|....|.|.....:    .|.:||...|.::.|.|||.::   
  Fly   230 MKFACFERTVELLYKYV----VPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSK--- 287

  Fly   234 AERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILG 291
                 ||:.:.|..|  .:....||||::.|..||::.|....|..:..||.....||
  Fly   288 -----LNQAKGASAI--SVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALG 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/88 (25%)
PTZ00168 25..281 CDD:185494 70/285 (25%)
Mito_carr 199..291 CDD:278578 26/96 (27%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 21/84 (25%)
Mito_carr <175..245 CDD:278578 17/71 (24%)
Mito_carr 260..338 CDD:278578 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2029217
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.