DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and PMP34

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster

Alignment Length:313 Identity:76/314 (24%)
Similarity:126/314 (40%) Gaps:48/314 (15%)


  Fly    17 KMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAG---------------- 65
            |:.:.::...|.|| |:|...|.:.....:|:|||::|||.|    .||                
  Fly     6 KLSQVLSYQNFVHA-VSGAAGGCIAMSTFYPLDTVRSRLQLE----EAGDVRSTRQVIKEIVLGE 65

  Fly    66 GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVP- 129
            ||:.:|:||.|.......:..::|.|:...|...|..:.::.|....:...|.|.::..|...| 
  Fly    66 GFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPF 130

  Fly   130 -VEIAKQRSQTLQGNKQSGLQILLRAYRT--EGLK--------RGLYRGFGSTIMREIPFSLIQF 183
             |...:.|.:.:.|....    :.:.|:.  ||||        .||:.|...::|. :....:||
  Fly   131 WVVNTRLRMRNVAGTSDE----VNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLML-VSNPALQF 190

  Fly   184 PLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERE----------S 238
            .::|..|......||.:....|....||:|...:..||.||.:|:|:.....:|          |
  Fly   191 MMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGS 255

  Fly   239 LNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILG 291
            ..|..|...::..|...:|..|||.|...::|...|..|..|..|:.....:|
  Fly   256 TPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVG 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/92 (27%)
PTZ00168 25..281 CDD:185494 73/294 (25%)
Mito_carr 199..291 CDD:278578 25/102 (25%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/86 (28%)
Mito_carr 105..202 CDD:278578 21/102 (21%)
Mito_carr 214..303 CDD:278578 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1988490
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.