DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and Mpcp1

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:129/288 - (44%) Gaps:48/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HALVAGGVAGMV----VDIALFPIDTVKTRLQSELGFWRA-----------GGFRGIYKGLAPAA 78
            |..:..|:.|::    ....:.|:|.||.|||.:...:::           .|.||:.||.||..
  Fly    73 HYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTF 137

  Fly    79 AGSAPTAALFFCTYECGKQFLSSVTQTKDS----PYVHMAAASAAEVLACLIRVPVEIAKQRSQT 139
            .|.:......|..||..|:........:::    ..:::||:::||..|.:...|:|.||.:.||
  Fly   138 IGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQT 202

  Fly   140 LQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFP--------LWEYFKLQWTPL 196
            ..|..::..:.|.:....||: ...|:|.....||:||:::::|.        |::|.    .|.
  Fly   203 TPGFAKTLREALPKMTAQEGV-TAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYV----VPK 262

  Fly   197 TGFDSTPFSVAL----CGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERG 257
            ...|.|.....:    .|.:||...|.::.|.|.|.::        ||:.:.|..:  .:..:.|
  Fly   263 PRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSK--------LNQAKGASAL--DVAKQLG 317

  Fly   258 FSGLFAGFVPRVLWI-TLGGAFFFGFYD 284
            :|||:.|.|||::.| ||..|.:| .||
  Fly   318 WSGLWGGLVPRIVMIGTLTAAQWF-IYD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/84 (26%)
PTZ00168 25..281 CDD:185494 71/283 (25%)
Mito_carr 199..291 CDD:278578 27/91 (30%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 22/86 (26%)
Mito_carr <188..258 CDD:278578 18/70 (26%)
Mito_carr 273..350 CDD:278578 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.