DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG8026

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:119/289 - (41%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IKMQEPVNKLKF-------FHALVAGGVAGMVVDIALFPIDTVKTRLQSELG------------- 60
            ||.|...:..||       :..||||...|:|..:.|.|:|.:|.|.....|             
  Fly     4 IKAQSTGSPKKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSS 68

  Fly    61 ----FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKD-SPYVHMAAASAAE 120
                .:|..||||:|||:.|...||..:..|:|..|...|.|:.....|.. .|.::|.||:.:.
  Fly    69 AFTTIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESG 133

  Fly   121 VLACLIRVPVEIAKQRSQTLQGNKQSG------LQILLRAYRTEGLKRGLYRGF--GSTIMREIP 177
            :|..|:..|:.:.|.| ..||.:..|.      :..|.:.|:.||: |||||||  |   |..:.
  Fly   134 ILTLLLTNPIWVVKTR-LCLQCDAASSAEYRGMIHALGQIYKEEGI-RGLYRGFVPG---MLGVS 193

  Fly   178 FSLIQFPLWEYFKLQWTPLTGFDSTPFSVALC-------GAVAGGISAGLTTPLDVVKTRIMLAE 235
            ...|||..:|..|..:..   :...|....|.       .||:..|:|..|.|..||:.|:    
  Fly   194 HGAIQFMTYEELKNAYNE---YRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARL---- 251

  Fly   236 RESLNRRRSARRILHGIYLERGFSGLFAG 264
            ::..:|.......:...:...|:.|.:.|
  Fly   252 QDHHHRYNGTWDCIKQTWRFEGYRGFYKG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/99 (29%)
PTZ00168 25..281 CDD:185494 76/280 (27%)
Mito_carr 199..291 CDD:278578 15/73 (21%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/280 (27%)
Mito_carr 23..115 CDD:278578 28/91 (31%)
Mito_carr 119..213 CDD:278578 30/101 (30%)
Mito_carr 220..307 CDD:278578 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.