DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG9582

DIOPT Version :9

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:307 Identity:68/307 - (22%)
Similarity:120/307 - (39%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSE------------------LG 60
            :|.:.:|.|..|..:..| |||::|.:..|...|:|.||||:|.:                  :.
  Fly     1 MATRSEETVRSLAHWQFL-AGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVK 64

  Fly    61 FWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACL 125
            .:|..|...::||:.|......|.....|..||..|.:. .....:.:|..|..:.|.|.:|...
  Fly    65 IYRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYF-QFGAPQPTPLTHAMSGSMAAILESF 128

  Fly   126 IRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLK-RGLYRGFGSTIMREIPFSLIQFPLWEYF 189
            :..|.|:.|...|..:|.:...|.::....:.:|.. :|||||..:.:.|...|....|..:...
  Fly   129 LVNPFEVVKITQQAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNAL 193

  Fly   190 KLQWTPLTGFDSTP------FSV---ALCGAVAGGISAGLTTPLDVVKTRIM--------LAERE 237
            |         |..|      :::   .:...:|..::..::..||:.|.||.        :..:.
  Fly   194 K---------DIVPSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQW 249

  Fly   238 SLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284
            :::..:|.       :.|.||..||.|....:|.:..|||.....|:
  Fly   250 TISTIKST-------FKEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 24/93 (26%)
PTZ00168 25..281 CDD:185494 64/291 (22%)
Mito_carr 199..291 CDD:278578 20/103 (19%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 64/291 (22%)
Mito_carr 17..104 CDD:278578 23/88 (26%)
Mito_carr 109..196 CDD:278578 21/95 (22%)
Mito_carr 216..295 CDD:278578 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.