| Sequence 1: | NP_651415.1 | Gene: | CG4743 / 43101 | FlyBaseID: | FBgn0039357 | Length: | 297 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572639.2 | Gene: | CG1628 / 31990 | FlyBaseID: | FBgn0030218 | Length: | 459 | Species: | Drosophila melanogaster |
| Alignment Length: | 41 | Identity: | 14/41 - (34%) |
|---|---|---|---|
| Similarity: | 18/41 - (43%) | Gaps: | 3/41 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 207 QVYGVPVPLMDEMDETTRWYNIFCPELTREQHWEIMESIMD 247 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4743 | NP_651415.1 | PTZ00168 | 25..281 | CDD:185494 | 14/41 (34%) |
| CG1628 | NP_572639.2 | Mito_carr | 170..252 | CDD:395101 | 5/9 (56%) |
| Mito_carr | 263..364 | CDD:395101 | |||
| Mito_carr | 369..456 | CDD:395101 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||