DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and CG1628

DIOPT Version :10

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:41 Identity:14/41 - (34%)
Similarity:18/41 - (43%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QVYGVPVPLMDEMDETTRWYNIFCPELTREQHWEIMESIMD 247
            |.:..|.|.| |:....:..||.  ||..:..|..||.|.|
  Fly   141 QPFAGPEPSM-EVPGFGKNSNIH--ELFGKMIWRKMEQIND 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 PTZ00168 25..281 CDD:185494 14/41 (34%)
CG1628NP_572639.2 Mito_carr 170..252 CDD:395101 5/9 (56%)
Mito_carr 263..364 CDD:395101
Mito_carr 369..456 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.