DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SPAC12B10.09

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_594641.1 Gene:SPAC12B10.09 / 2542695 PomBaseID:SPAC12B10.09 Length:345 Species:Schizosaccharomyces pombe

Alignment Length:269 Identity:125/270 (46%)
Similarity:166/270 (61%) Gaps:7/270 (3%)


  Fly    25 LKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAGSAPTAALFF 89
            :.||.||.||..||:.||::||||||:|||||::.||.:.|||.|:|:||.....||||.|:|||
pombe    80 MSFFEALGAGICAGLAVDLSLFPIDTLKTRLQAKGGFVKNGGFHGVYRGLGSILVGSAPGASLFF 144

  Fly    90 CTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRA 154
            .|||..|..||........|.:||.:||..|:.||::|||.|:.|||:|. .|...|...||...
pombe   145 TTYENMKSRLSQSGLGLSDPQIHMCSASLGEIAACIVRVPTEVIKQRAQA-SGGTLSSRNILQTI 208

  Fly   155 YRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQW-TPLTGFDSTPFSVALCGAVAGGISA 218
            .::..:.|..|.|:|.||.|||||:|||||:||:.||:| ...:...:.....|:.|::||||:|
pombe   209 LKSNNVWRDFYAGYGITIAREIPFTLIQFPIWEHLKLKWRIKHSRNKNLAHEAAISGSIAGGIAA 273

  Fly   219 GLTTPLDVVKTRIMLAERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFY 283
            .||||.||||||||.::     :|.|....:..|....||..|:.|.||||||::.|||.|.|.|
pombe   274 ALTTPFDVVKTRIMTSQ-----QRLSYVFTIKSIVAHEGFLALYKGIVPRVLWLSGGGAIFLGCY 333

  Fly   284 DLTTRILGA 292
            |:....:.|
pombe   334 DVILNFMKA 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 42/74 (57%)
PTZ00168 25..281 CDD:185494 121/257 (47%)
Mito_carr 199..291 CDD:278578 39/92 (42%)
SPAC12B10.09NP_594641.1 Mito_carr 78..154 CDD:278578 42/74 (57%)
PTZ00168 80..332 CDD:185494 122/258 (47%)
Mito_carr 164..244 CDD:278578 38/81 (47%)
Mito_carr 263..340 CDD:278578 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6834
Inparanoid 1 1.050 232 1.000 Inparanoid score I844
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003484
OrthoInspector 1 1.000 T1125095
orthoMCL 1 0.900 OOG5_128405
Panther 1 1.100 LDO PTHR45667
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1767
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.