DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4743 and SPCC1442.03

DIOPT Version :8

Sequence 1:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_588318.1 Gene:SPCC1442.03 / 2538899 PomBaseID:SPCC1442.03 Length:338 Species:Schizosaccharomyces pombe

Alignment Length:317 Identity:97/318 (31%)
Similarity:142/318 (45%) Gaps:57/318 (18%)


  Fly    27 FFHALVAGGVAGMVVDIALFPIDTVKTRLQSEL------GFWRA--------GGFRGIYKGLAPA 77
            :.|.|:|||:.|...|..:..:||||||.|:.|      |..:.        |.|.|:|.|:.|.
pombe    15 YSHVLIAGGIGGATADFLMHSLDTVKTRQQAALYTNKYNGMVKCYSTILCEEGVFHGLYSGVCPM 79

  Fly    78 AAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQG 142
            ..||.|..||||.:||..|:.|.|.....:: ...:.|....::.|.::.||.|:.|.|.| |||
pombe    80 LIGSLPATALFFSSYEYTKRHLMSNYNLPET-LCFLLAGFVGDLFASVVYVPSEVLKTRLQ-LQG 142

  Fly   143 -----------NKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPL 196
                       |..|....:.:..:.||:|...| |:.:||:|:||||..|...:|..:......
pombe   143 RYNNPHFQSNYNYPSFRGAVKQIAKQEGMKTFFY-GYRATILRDIPFSGFQLLFYEKLRQVAQKE 206

  Fly   197 TG-FDSTPFSVALCGAVAGGISAGLTTPLDVVKTRI-------------------MLAERESLNR 241
            .| .|...|...:.|::||..:..|||||||.|||:                   ..|:.|:...
pombe   207 CGQKDIGVFRELITGSLAGAGAGFLTTPLDVAKTRLQTMIRTTDKVSDDINSGRYFFAKDENSKS 271

  Fly   242 RRSA---------RRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRI 289
            :.:|         |.:|.|:|...|..|||.||.||:.|.:...:..|.||:...|:
pombe   272 KSAASLVKPKIGIRHVLGGLYKSEGLLGLFRGFGPRIFWTSSQSSLMFVFYEGIIRL 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 32/86 (37%)
PTZ00168 25..281 CDD:185494 94/308 (31%)
Mito_carr 199..291 CDD:278578 35/120 (29%)
SPCC1442.03NP_588318.1 Mito_carr 10..105 CDD:278578 34/90 (38%)
Mito_carr 114..205 CDD:278578 27/93 (29%)
Mito_carr 210..333 CDD:278578 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45667
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.