DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and znf1043

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_009299198.1 Gene:znf1043 ZFINID:ZDB-GENE-080215-14 Length:476 Species:Danio rerio

Alignment Length:441 Identity:104/442 (24%)
Similarity:170/442 (38%) Gaps:94/442 (21%)


  Fly    22 EAPVKLVSHE-VSLSDSTTS-----LELSNC---CRLCLEEPYPNQMLDMTV-IYDQEAALSYYD 76
            :.|.::::.| .:|:..|:|     ...|.|   |:.|.........||:.: ::.:|..   |.
Zfish    50 QKPQEIMTDEKPTLTKKTSSHGRPQKSKSGCNFSCKQCRNSFSQKSKLDVHMRVHTREQP---YT 111

  Fly    77 CYEICTK-----EDLRQNPK---NEPRTLCKRCAVELKWAYDFHKKMAI-------ANQQLREIF 126
            | |.|.|     :..:.:.:   .|.:..|:.|......|.:|...|.|       :.:|..:.|
Zfish   112 C-EQCGKSFGQIQGFKAHMRIHTGEGKFTCQECGKSFYQAGNFAAHMRIHTGEKPFSCKQCGKSF 175

  Fly   127 VATEANTEQEDDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPRNRHTGKSNCKFCHKEFR 191
             :.::|.:....|...|      :.:..|:. .|....|.|.:..:..:...||..|:.|.|.|.
Zfish   176 -SQKSNLDVHMRVHTRE------QPYTCEQC-GKSFGQIQSFKAHMRIHTGEGKFTCQECGKSFY 232

  Fly   192 NHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIH 256
            .....|.|..||...:| |.|.||.:.:..|..|.||:....|:....|:.|||.|:..::...|
Zfish   233 QAGNFAAHMRIHTGEKP-FSCKQCGKSFSQKSNLDVHMRVHTREQPYTCEQCGKSFSQKQSFNTH 296

  Fly   257 KRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSR-FICEFPG-------------------- 300
            .|.|..:.|:||..|.:.|.|:.:|.||.:| |:|.: ..||..|                    
Zfish   297 MRIHTGEKPFSCKQCGKSFFQKPNLDVHMRV-HTGEKPHTCEQCGKSFGQKQDLYIHMRIHTGEK 360

  Fly   301 ------CQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHLE--------------- 343
                  |.|||...|:|::|...||. .||.||.|.:|:..:..|:.|:.               
Zfish   361 PYTCTECGKSFPHISTLKHHMRIHTGEKPFACAQCGKSFTTKTSLKNHMNGHTGTIVFTCDQCGK 425

  Fly   344 --------RKHNMVVQMED---LEEMRK-FHIVRSKLVMAKIYSDQKESHH 382
                    :||......||   ..|..| |...||.....|:::.::...|
Zfish   426 SLTRKDTIKKHMKTHSREDRFRCSECGKGFKSKRSLNTHMKLHNGEESPQH 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 19/97 (20%)
C2H2 Zn finger 183..203 CDD:275368 7/20 (35%)
C2H2 Zn finger 212..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 7/20 (35%)
C2H2 Zn finger 268..289 CDD:275368 8/21 (38%)
C2H2 Zn finger 296..318 CDD:275368 10/48 (21%)
C2H2 Zn finger 325..346 CDD:275368 7/44 (16%)
znf1043XP_009299198.1 COG5048 67..468 CDD:227381 100/415 (24%)
C2H2 Zn finger 84..104 CDD:275368 4/20 (20%)
C2H2 Zn finger 112..132 CDD:275368 4/21 (19%)
C2H2 Zn finger 140..160 CDD:275368 6/20 (30%)
zf-H2C2_2 152..177 CDD:290200 5/26 (19%)
C2H2 Zn finger 168..188 CDD:275368 4/21 (19%)
zf-H2C2_2 180..203 CDD:290200 5/30 (17%)
C2H2 Zn finger 196..216 CDD:275368 4/21 (19%)
C2H2 Zn finger 224..244 CDD:275368 7/20 (35%)
zf-H2C2_2 236..261 CDD:290200 9/26 (35%)
C2H2 Zn finger 252..272 CDD:275368 7/20 (35%)
zf-H2C2_2 264..289 CDD:290200 9/25 (36%)
C2H2 Zn finger 280..300 CDD:275368 7/20 (35%)
zf-H2C2_2 292..315 CDD:290200 7/23 (30%)
C2H2 Zn finger 308..328 CDD:275368 8/21 (38%)
zf-H2C2_2 320..343 CDD:290200 9/24 (38%)
C2H2 Zn finger 336..356 CDD:275368 3/20 (15%)
zf-H2C2_2 348..371 CDD:290200 3/23 (13%)
C2H2 Zn finger 364..384 CDD:275368 7/20 (35%)
zf-H2C2_2 377..401 CDD:290200 10/24 (42%)
C2H2 Zn finger 392..412 CDD:275368 6/20 (30%)
C2H2 Zn finger 420..440 CDD:275368 2/20 (10%)
C2H2 Zn finger 448..468 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.