DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and si:ch211-212k5.4

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017211232.1 Gene:si:ch211-212k5.4 ZFINID:ZDB-GENE-110914-68 Length:325 Species:Danio rerio

Alignment Length:266 Identity:75/267 (28%)
Similarity:107/267 (40%) Gaps:41/267 (15%)


  Fly   115 MAIANQQLREIFVATEANTEQEDDVEDEENEADMNEEFLMEEIEEK--QETPIDSLEDIVPRNRH 177
            ||...::..::.:......:|||..|..:......|.....|:|||  ||...|....:..:...
Zfish     1 MAFIKEESEDVKIEETFRVKQEDPQEQTDLMVLKEETHQWNEMEEKKHQEITTDEKPTLTKKTSS 65

  Fly   178 TG-----KSNCKF----CHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKH 233
            .|     ||.|.|    |.|.|...|.:..|..:|...:| :.|.||.:.:.|...|.||:....
Zfish    66 RGRPRKSKSGCNFSCKRCRKSFSQRSNLDVHMRVHTGEKP-YTCEQCGKSFYTIGNLTVHMRIHT 129

  Fly   234 RQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSR-FICE 297
            .:....|..|||.|.....|..|.|.|..:.||||..|.:.:.|..:|.||.:. |:|.| |||.
Zfish   130 GERPYACQKCGKSFYTTGNLAAHMRIHTGEEPYSCLQCGKSYKQNGNLEVHMRT-HTGERSFICT 193

  Fly   298 FPG--------------------------CQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPAR 335
            ..|                          |.|||...::|.:|..:||. .||.||||.:|:..:
Zfish   194 QCGKGFSQKQNLTIHMRIHTGEKPYTCTECGKSFRCKNTLDHHMISHTGEKPFACAHCGKSFTTK 258

  Fly   336 NKLRMH 341
            .:|..|
Zfish   259 ARLMNH 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 2/9 (22%)
C2H2 Zn finger 183..203 CDD:275368 7/24 (29%)
C2H2 Zn finger 212..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..289 CDD:275368 6/21 (29%)
C2H2 Zn finger 296..318 CDD:275368 8/48 (17%)
C2H2 Zn finger 325..346 CDD:275368 7/18 (39%)
si:ch211-212k5.4XP_017211232.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.