DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and znf1072

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017211094.1 Gene:znf1072 ZFINID:ZDB-GENE-110913-146 Length:361 Species:Danio rerio

Alignment Length:330 Identity:80/331 (24%)
Similarity:127/331 (38%) Gaps:75/331 (23%)


  Fly    75 YDCYEICTKE---------DLRQNPKNEPRTLCKRCAVELKWAYDFHKKMAIAN-------QQLR 123
            |.|.. |.|.         .:|.:.|.:|.| ||:|.....:...|...|:|..       ||..
Zfish    82 YSCTR-CRKSFSKKSNLDIHMRVHTKEKPYT-CKQCGKSFGYIQGFENHMSIHTGERPYTCQQCG 144

  Fly   124 EIF-----VATEANTEQEDDVEDEENEADMNEEFLMEEIEEKQETPIDSLEDIVPRNRHTG--KS 181
            :.|     .|....|                                           |||  |.
Zfish   145 KSFYHAGNFAAHMRT-------------------------------------------HTGERKY 166

  Fly   182 NCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKV 246
            .|:.|.|.|.....:|.|..||...:| :.||||.:.:.....||:|:.:.:.:....|..|||.
Zfish   167 TCQHCGKSFSKTGNLAVHMRIHTGEKP-YSCSQCGKSFKQNVTLKIHMRTHNEERIFTCTQCGKS 230

  Fly   247 FAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSR-FICEFPGCQKSFTSSSS 310
            .:....|:||.|.|..:.||:|..|.:.|..:..|. |..:.|:|.: |.|  ..|.||||:.:|
Zfish   231 ISHKHYLDIHMRIHTGEKPYTCTECGKSFPYKGSLK-HHMLSHTGEKPFTC--AQCGKSFTTKTS 292

  Fly   311 LRNHECTHTA-MPFECAHCHQSYPARNKLRMHLERKHNMVVQMEDLEEMRKFHIVRSKLVMAKIY 374
            |.||...||. :.|.|..|.:::..::.::.|: :.|:........|..:.|...||.....|::
Zfish   293 LMNHMDGHTGIIVFTCDQCGKTFTRKDSMKQHM-KTHSGEDSFRCSECGKGFKCKRSLSTHLKLH 356

  Fly   375 SDQKE 379
            :.:::
Zfish   357 NGERK 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 16/65 (25%)
C2H2 Zn finger 183..203 CDD:275368 7/20 (35%)
C2H2 Zn finger 212..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 8/20 (40%)
C2H2 Zn finger 268..289 CDD:275368 5/21 (24%)
C2H2 Zn finger 296..318 CDD:275368 10/22 (45%)
C2H2 Zn finger 325..346 CDD:275368 3/21 (14%)
znf1072XP_017211094.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.