DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and si:dkey-262g12.3

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_009299305.1 Gene:si:dkey-262g12.3 ZFINID:ZDB-GENE-060503-255 Length:389 Species:Danio rerio

Alignment Length:341 Identity:87/342 (25%)
Similarity:144/342 (42%) Gaps:52/342 (15%)


  Fly    30 HEVSLSDSTTSLELSNCCRLCLEEPYPNQMLDMTV-IYDQEAALSYYDC-----YEICTKEDLRQ 88
            |.:.:..|..:.|..:.|..|.:.....|.|.:.: |:..|...|...|     ..|..:..:|.
Zfish    89 HNLRVHMSAHTREKPHLCPECGKSFRRKQYLAVHMRIHTGEKPFSCDQCGKSFRQSIILRHHIRL 153

  Fly    89 NPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQLREIFVATEANTEQEDDVEDEENEADMNEEFL 153
            :...:|.. |.:|.|.........|.||:.|:.  :.||..:.                 .:.|.
Zfish   154 HTGEKPYA-CPQCGVRYIHKQRLEKHMAVHNED--KPFVCPQC-----------------GKSFT 198

  Fly   154 MEEIEEKQETPIDSLEDIVPRNRHTGKSN--CKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCD 216
            : .:..||...|           |||:..  |:.|.|.|.:..::..|..:|...|| :.||||.
Zfish   199 L-NLNLKQHMKI-----------HTGEKPFVCQQCGKSFNHKQQVEVHMRVHTGERP-YICSQCG 250

  Fly   217 RVYLTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHL 281
            :.:..|..|..|:.:..|:....|..||:......:|:.|.|.|....||:|..|.:.||:||.|
Zfish   251 KSFTQKGNLDHHMRTHARERPYTCTKCGRNLTSQSSLDAHMRTHTEKKPYACSECGQSFAKRSVL 315

  Fly   282 TVHQQVKHSGSR-FICEFPGCQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHLER 344
            .||::. |:|.: :.|  ..|.|::||.:.|::|..|||. .||.|..|.:|:..|..|..|: :
Zfish   316 KVHRRA-HTGEQTYTC--TRCGKNYTSKTYLKSHMRTHTGEKPFVCGQCGKSFYHRGSLSYHM-K 376

  Fly   345 KHNMVVQMEDLEEMRK 360
            .|:     |:.:::.|
Zfish   377 SHS-----EEQKQISK 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 18/84 (21%)
C2H2 Zn finger 183..203 CDD:275368 5/20 (25%)
C2H2 Zn finger 212..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..289 CDD:275368 9/21 (43%)
C2H2 Zn finger 296..318 CDD:275368 8/22 (36%)
C2H2 Zn finger 325..346 CDD:275368 6/21 (29%)
si:dkey-262g12.3XP_009299305.1 COG5048 <54..225 CDD:227381 33/168 (20%)
C2H2 Zn finger 78..98 CDD:275368 2/9 (22%)
C2H2 Zn finger 106..126 CDD:275368 5/20 (25%)
C2H2 Zn finger 134..154 CDD:275368 3/20 (15%)
C2H2 Zn finger 162..182 CDD:275368 6/20 (30%)
C2H2 Zn finger 190..210 CDD:275368 4/49 (8%)
C2H2 Zn finger 218..238 CDD:275368 5/20 (25%)
SFP1 <235..323 CDD:227516 30/90 (33%)
C2H2 Zn finger 246..266 CDD:275368 7/20 (35%)
C2H2 Zn finger 274..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 9/21 (43%)
C2H2 Zn finger 330..350 CDD:275368 8/22 (36%)
zf-H2C2_2 342..367 CDD:316026 10/25 (40%)
C2H2 Zn finger 358..378 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.