DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and LOC100330167

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005174611.1 Gene:LOC100330167 ID: Length:325 Species:Danio rerio

Alignment Length:256 Identity:63/257 (25%)
Similarity:111/257 (43%) Gaps:37/257 (14%)


  Fly   115 MAIANQQLREIFVATEANTEQEDDVEDEENEADMNEEFLMEEIE------EKQETPIDSLED--- 170
            ||...::..::.:......:.||  .::...|.::...|.||.|      ||.:....|..:   
Zfish     1 MAFIKEESEDLKIEDTFTVKHED--AEQHTAAPVHLTGLKEECEAVTVAQEKNQNDKHSASEEKV 63

  Fly   171 --------------IVPRN--RHTGKSNCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVY 219
                          :.|.|  |:.    |:.|.|||..:..:..|..||...:| |.|..||:.:
Zfish    64 AYYPQPYKRRGPYKLKPYNFIRYI----CQHCGKEFSQNGNLQAHIRIHTGEKP-FSCKLCDKSF 123

  Fly   220 LTKQALKVHVDSKHRQSGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVH 284
            ..|..|::|:.:........|..||:.|....|..:|.:.|..|...:|..|.:.|::.::|..|
Zfish   124 TQKSHLQIHLRAHVEGMSFTCQHCGRHFTQKNAFMVHLKVHTADRSKTCKTCGKTFSRSANLLEH 188

  Fly   285 QQVKHSGSR-FICEFPGCQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHLE 343
            .:| |:|:| |.|:.  |.|:|...::||||...||. .|:.|.:|.:.:......::|::
Zfish   189 VRV-HTGARPFGCQH--CGKTFAKKTTLRNHTKIHTGEKPYRCPYCGKGFIQPTNYKVHIK 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 2/9 (22%)
C2H2 Zn finger 183..203 CDD:275368 7/20 (35%)
C2H2 Zn finger 212..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..289 CDD:275368 6/21 (29%)
C2H2 Zn finger 296..318 CDD:275368 8/22 (36%)
C2H2 Zn finger 325..346 CDD:275368 3/20 (15%)
LOC100330167XP_005174611.1 zf-C2H2 86..108 CDD:278523 7/26 (27%)
C2H2 Zn finger 88..108 CDD:275368 7/20 (35%)
COG5048 <91..218 CDD:227381 41/131 (31%)
zf-H2C2_2 100..125 CDD:290200 8/26 (31%)
C2H2 Zn finger 116..164 CDD:275368 12/48 (25%)
C2H2 Zn finger 144..161 CDD:275368 6/17 (35%)
C2H2 Zn finger 172..192 CDD:275368 6/21 (29%)
C2H2 Zn finger 200..220 CDD:275368 8/22 (36%)
zf-H2C2_2 213..237 CDD:290200 9/24 (38%)
C2H2 Zn finger 228..248 CDD:275368 3/20 (15%)
C2H2 Zn finger 256..276 CDD:275368
C2H2 Zn finger 284..304 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.