DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4730 and LOC100150619

Sequence 1:NP_001262965.1 Gene:CG4730 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001314928.1 Gene:LOC100150619 ID: Length:392 Species:Danio rerio

Alignment Length:243 Identity:71/244 (29%)
Similarity:114/244 (47%) Gaps:27/244 (11%)


  Fly   121 QLREIFVATEANTEQEDD---VEDE---ENEADMNEEFLMEEIEEKQETPIDSLEDIV------- 172
            ::.|.|...:.:.:::.|   :::|   :||.|..::|     |:.:|...|....:.       
Zfish    12 KIEETFTVKQGDPQEQTDLMVLKEETRGQNEIDEKQQF-----EKPKEIMTDEKPTLTKKTSSHG 71

  Fly   173 -PRNRHTG-KSNCKFCHKEFRNHSRMAKHQMIHLANRPNFRCSQCDRVYLTKQALKVHVDSKHRQ 235
             ||...:| ..:||.|.|.|...|::..|..:|...:| |.|..|.:.:...|..|.|:.....:
Zfish    72 RPRKSKSGCNFSCKQCRKSFSQKSKLDVHMRVHTREQP-FTCKPCGKSFGQIQGFKAHIRYHTGE 135

  Fly   236 SGVHCDTCGKVFAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGSR-FICEFP 299
            ....|..|||.|..|..|..|.|.|..:.|:||..|.:.|:|:|:|.:|.:| |:|.: :.||  
Zfish   136 RKFPCQQCGKSFYYAGNLAAHMRIHTGEKPFSCKQCGKSFSQKSNLEIHMRV-HTGEKPYTCE-- 197

  Fly   300 GCQKSFTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHLERKH 346
            .|.|||:....|:.|..|||. .||.|..|.:|:..:..|..|: |.|
Zfish   198 QCGKSFSQKQCLKTHMRTHTGEKPFSCKQCRKSFSKKLTLIAHI-RVH 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 0/3 (0%)
C2H2 Zn finger 183..203 CDD:275368 7/20 (35%)
C2H2 Zn finger 212..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 9/20 (45%)
C2H2 Zn finger 268..289 CDD:275368 8/21 (38%)
C2H2 Zn finger 296..318 CDD:275368 9/22 (41%)
C2H2 Zn finger 325..346 CDD:275368 6/21 (29%)
LOC100150619NP_001314928.1 C2H2 Zn finger 84..104 CDD:275368 7/20 (35%)
C2H2 Zn finger 112..132 CDD:275368 5/20 (25%)
C2H2 Zn finger 140..160 CDD:275368 9/20 (45%)
zf-H2C2_2 152..177 CDD:290200 9/25 (36%)
COG5048 <164..324 CDD:227381 32/86 (37%)
C2H2 Zn finger 168..188 CDD:275368 8/21 (38%)
zf-H2C2_2 180..205 CDD:290200 11/28 (39%)
C2H2 Zn finger 196..216 CDD:275368 9/22 (41%)
zf-H2C2_2 209..232 CDD:290200 10/23 (43%)
C2H2 Zn finger 224..244 CDD:275368 6/21 (29%)
C2H2 Zn finger 252..272 CDD:275368
zf-H2C2_2 264..287 CDD:290200
COG5048 276..>385 CDD:227381
C2H2 Zn finger 280..300 CDD:275368
zf-H2C2_2 292..317 CDD:290200
C2H2 Zn finger 308..328 CDD:275368
C2H2 Zn finger 336..356 CDD:275368
C2H2 Zn finger 364..384 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.