DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5107 and CG8661

Sequence 1:NP_651401.1 Gene:CG5107 FlyBaseID:FBgn0039342 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_573212.1 Gene:CG8661 FlyBaseID:FBgn0030837 Length:198 Species:Drosophila melanogaster

Alignment Length:166 Identity:55/167 (33%)
Similarity:89/167 (53%) Gaps:8/167 (5%)


  Fly    49 ELDNDTD-YMDVEAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSYVDAIDACGTAIPK 112
            |||:.|| .::||..|.:.|..|.|:.||::::|.|||||.|..|..|.|.:...:..||....|
  Fly    31 ELDDVTDGSLEVEDFGVLSTTYKSLKIALRSIKGLNCIIKWVAGIKDSATQFNTDVVVCGVTASK 95

  Fly   113 DVAKIVDSVKEIIKICDDILHLHSKLC-ATDKSVGSSIKNSAKCFWKLFKASMRLTRKINKTLKL 176
            ||.|::::..:|:..|:|:::|.|..| .||   ....|.|..||.|..:....|.::::..:||
  Fly    96 DVTKLINANNKILSTCNDLINLRSNTCPQTD---DEETKVSGSCFVKTLRKVWSLKKQVDNAIKL 157

  Fly   177 IAKLP---ADTSSCFVNATNKVTASFNSFLPNIDVC 209
            ..|:|   .:..:|..:|.|.:|..:.:|..||..|
  Fly   158 AKKIPQTGPNAVACVSDAVNTLTTYYTAFPQNIISC 193



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134665435
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.