DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5107 and CG8664

Sequence 1:NP_651401.1 Gene:CG5107 FlyBaseID:FBgn0039342 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001285370.1 Gene:CG8664 FlyBaseID:FBgn0030836 Length:214 Species:Drosophila melanogaster

Alignment Length:220 Identity:96/221 (43%)
Similarity:138/221 (62%) Gaps:14/221 (6%)


  Fly     1 MKAITVCLLVLVSATCLLTTRANAIELLENENFDYDFDFE------SELEQLLDELDNDTDYMDV 59
            ||.:.|||||:.||:.||.| |||..:...|:|:...|.|      :||..:.||      :|.|
  Fly     1 MKVLNVCLLVVASASFLLAT-ANASAVGAFEDFEPYTDAELKDLYAAELMAMEDE------FMGV 58

  Fly    60 EAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSYVDAIDACGTAIPKDVAKIVDSVKEI 124
            |..|||.:|.|||....|.:.||.||::||.|:|.:||:|||.:..|...||||:..::::||::
  Fly    59 EQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLTCTNYVDDLSTCTGDIPKDIQAMLNNVKQM 123

  Fly   125 IKICDDILHLHSKLCA-TDKSVGSSIKNSAKCFWKLFKASMRLTRKINKTLKLIAKLPADTSSCF 188
            |...:.|:::.|:||| |.:||.||.|:..:|..|.|.|:|.|.|::|..:|..|.||.:||||:
  Fly   124 IITSNKIINMKSELCASTSRSVVSSTKSFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCY 188

  Fly   189 VNATNKVTASFNSFLPNIDVCIESM 213
            |:||.||....|:|:|||:.||.||
  Fly   189 VDATKKVVDGCNAFVPNINTCIASM 213



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134665422
eggNOG 1 0.900 E1_2F7VM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.