DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5112 and Qrsl1

DIOPT Version :10

Sequence 1:NP_651400.1 Gene:CG5112 / 43083 FlyBaseID:FBgn0039341 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001074523.1 Gene:Qrsl1 / 76563 MGIID:1923813 Length:525 Species:Mus musculus


Alignment Length:42 Identity:14/42 - (33%)
Similarity:19/42 - (45%) Gaps:1/42 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NKIDKDNEIYARNVIRVPMTPHSILLETLPRVHTSGNSSPKN 111
            ||.|::|:.........|:.|..|..:..|.| ||.|.|..|
Mouse   174 NKSDQENDQLPSQAGPPPLPPAPIQHKQHPSV-TSLNQSLAN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5112NP_651400.1 GatA 50..520 CDD:439924 14/42 (33%)
Qrsl1NP_001074523.1 GatA 1..492 CDD:439924 14/42 (33%)

Return to query results.
Submit another query.