| Sequence 1: | NP_651396.1 | Gene: | CG4553 / 43078 | FlyBaseID: | FBgn0039336 | Length: | 363 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001038718.1 | Gene: | ngrn / 569275 | ZFINID: | ZDB-GENE-060503-19 | Length: | 289 | Species: | Danio rerio |
| Alignment Length: | 353 | Identity: | 76/353 - (21%) |
|---|---|---|---|
| Similarity: | 136/353 - (38%) | Gaps: | 103/353 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 LARAPRRANPG-LGYQLEQLQEHPEKSSEAS--EDYADLESDFMDVQKTHRQYEREQQQHRDRIR 79
Fly 80 QFMIKHKYFRDAKLPNLLLHAEK-EQMRLLHERDPEEWSVERLAESFPATPDIVQKILRAKWRPR 143
Fly 144 SVQRIRSHDETVIKNWQLLGTGKGDFSIPPSL-LQHLQ--KFAERRWQDLRELKIQDWPTKSQLP 205
Fly 206 T---PQGNEFRKLLGSSSKTTEEMPTPQIPSGYEAPPSAAEDETYLL-------DKIRNKKKMRL 260
Fly 261 QELKELQLVESAPAVPEEMKRPIENPSGTGFLPSFVPKFASSEIVISAADQRKYEITQVKTRIVI 325
Fly 326 PRKLHRQGATYRVEDAYYDDDGELLYRV 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4553 | NP_651396.1 | Neugrin | 103..>157 | CDD:283952 | 18/53 (34%) |
| ngrn | NP_001038718.1 | Neugrin | 87..289 | CDD:283952 | 60/278 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D322069at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0008328 | |
| OrthoInspector | 1 | 1.000 | - | - | oto41116 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR13475 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5347 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 6.100 | |||||