DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rha and Cep120

Sequence 1:NP_651390.2 Gene:rha FlyBaseID:FBgn0027376 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001178626.1 Gene:Cep120 RGDID:1565619 Length:989 Species:Rattus norvegicus

Alignment Length:1324 Identity:256/1325 (19%)
Similarity:453/1325 (34%) Gaps:407/1325 (31%)


  Fly    30 SDQVYCVLLHVVEAINFIGRDATDRQQIVMNAALNSVDFEVEGTQSEETIIFNSNCIWECDLAGI 94
            |||: .:::.::|..:|..|   .:..:|:.|..:......:.....:...|.:...||.|...:
  Rat     5 SDQL-LIVVSILEGRHFPKR---PKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKVL 65

  Fly    95 KRLKTDHRPVKMTFYACRGGGAERKTIGTLLLPVRGLPVLGTVGSHNSPHLKMFWHKLICTSSEF 159
            .:.:....|:|:..:|.....:.::|:|.::|.:|     ....:..:|.    |::|:  |:::
  Rat    66 HQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLR-----TAQETKQAPK----WYQLL--SNKY 119

  Fly   160 RSHKPEVLLMLTIIKKSILHTKDFEHFMQFTEVKSPPTPPMQSPGHSITASMLQSQANVYVQSL- 223
            ...|.||.:.:|:         :.:...|....|:...||...   .:.||:|.......|..| 
  Rat   120 TKFKSEVQISITL---------ETDTKAQVDSFKAKGAPPRDG---KVPASLLGVDPKDIVAVLN 172

  Fly   224 -----VQLGLLQVGNDPLVDCDIIEVVLQLKQLRNVTGLVKSLNQGKPPSSVILVFDFVGN-VTN 282
                 .|:|..:...|.......|....||:||...|   ..|.:.:|  .....:..:|| |||
  Rat   173 EEGGYHQIGPAECCTDSFTLSVTIAFATQLEQLIPCT---MKLPERQP--EFFFYYSLLGNDVTN 232

  Fly   283 IELKLNESDTYTLN---DVLGLRFKTSLRSMRLYFQRIFYLPINMYMNGTAIAHYRMDFTNLLPA 344
            ...    ||....|   :...:|.::|:..:|:|......|.|::.....::....:..:.||  
  Rat   233 EPF----SDLINPNFEPERASVRIRSSVEVLRVYLALHSKLQIHLCCGDQSLGSTEIPLSGLL-- 291

  Fly   345 DDFFSDNRKYTSNGSFSFNRFGRTDSGREPKPPLMEYTFSVDLKTIFSRQEQEEPERTPSIASGN 409
                       ..||...|:          .|..:|..|::|           .|.|        
  Rat   292 -----------KKGSTEINQ----------HPVTVEGAFTLD-----------PPNR-------- 316

  Fly   410 LDSEDEQYLGQTFCASVVRSRLNLNESEETDEIASNVMKQLANDSETEVIEMKSNTKNSKHNTSP 474
                             .:.:|.....|....:..:|..|........:||:|  |:|..   .|
  Rat   317 -----------------AKQKLAPVPVELAPTVGVSVALQREGIGSQSLIELK--TQNGH---EP 359

  Fly   475 QRKSQESKKLIRESS----RNTRNSLENLQNVDELTSLDLFELEEKRQEKIAELERIKAGQSE-- 533
            :...:.....|:|.:    ::.|.|....||....|..|..|.|.:..:...|.:::..|...  
  Rat   360 EHSQKRVLTPIKEKTLTGPKSPRVSPAPPQNQTPPTKDDATESEVESLQYDKEPKQVVKGTGSIP 424

  Fly   534 -SLLQTELKVKKHKKADLELQGKKSQLETINE---VPPKS--------------LRKSKPVSQSE 580
             ||.|.            |..|..|::.|..:   ||..|              |..|.||:...
  Rat   425 ASLAQP------------EATGNPSEVVTSGQKIAVPATSHHFCFSIDLRSIHGLEISFPVNCIL 477

  Fly   581 LNNVPKIQENLPILNNQTKGSRIQKENCEENNEDLSYALSEEHSSSNEKLDKKPGASKTMRPPEH 645
            ..:.|......||:.|..          .|..:::...|.:.:.:.:         ..|| |.:.
  Rat   478 RYSYPFFGSAAPIMTNPP----------VEVRKNMEVFLPQSYCAFD---------FATM-PHQL 522

  Fly   646 VDTDLETDISVFSIQKKRKSKSKL--VISNELHNFEDSSTDTLEKGRPNPSKGDLKLRARWVE-V 707
            .||.|...:.|....|.:.||..|  :...:|.|...|     ||.|...:.|:...|..:.| |
  Rat   523 QDTFLRIPLLVELWHKDKMSKDLLLGIARIQLSNILSS-----EKTRFLGANGEQCWRQTYSEKV 582

  Fly   708 NKVQTQALIETEKFLQKTCPAE------LDEVLYED----QVALGQAKTSKPTKRKVKKPEEDKV 762
            ..:..|........|..|...|      :.|:...:    ..|:|| :.|.|.......|.|.:|
  Rat   583 PVIAAQGSNNRIVDLSYTMTLEDYGLVKMREIFVSESSQGMSAVGQ-RASPPPPPPAPCPSEIQV 646

  Fly   763 ---KRIDYETSYEEEITFCHPEKDPMTMIGENPINLNDLAS----SEEYISISEGNSKPAEIVYT 820
               :.::|:.:.|.|:.     |:....|.|:.:...:||.    :||:                
  Rat   647 EPRETLEYKAALELEMW-----KEMQEDIFESQLKQKELAHMQALAEEW---------------- 690

  Fly   821 ETEQRVTFVNPKRDREKKKLSSLSKDDLLVEVRSEEYINLRSSARSKTDCVRKK-KKISIHEDQV 884
                      .|||||::.|                              |:|| .:.||.|.::
  Rat   691 ----------KKRDRERESL------------------------------VKKKVAEYSILEGKL 715

  Fly   885 YQAELTPSEEPSSQSESRGTDNANPITDQPQVDRVKKKKRDTSGDQQLFHVEYTSSQKSISKTEG 949
            .|| ||..|....|.          :|.:.::.|.:|       :.||      ..::::.:.:.
  Rat   716 QQA-LTELESREQQL----------VTAETELQRERK-------ELQL------ERERNLQELQD 756

  Fly   950 NVK-----CKELIEPDVEQTDVQVLKKKKLKKTLVTNDTVAQDYETLEEETIKPVKK-KIVRKKS 1008
            :|:     |       |.|.:::.||.|:|:          :|...|:::......| ||:.|. 
  Rat   757 SVRRARDDC-------VHQVELERLKLKQLE----------EDKHRLQQQLNDAENKYKILEKD- 803

  Fly  1009 SVILEKIEDTENKGPADEVVSVEAKKIIKKKAKPACDNPTVEEYPKTKKGESRKLKSTSKEHFTM 1073
               .::.:|.:|..|...:.| |...:            |:|:....:|.||   .:.||.|:..
  Rat   804 ---FQQFKDQQNNKPEIRLQS-EINLL------------TLEKVELERKLES---ATKSKLHYKQ 849

  Fly  1074 EKPSSTIDSIGQKIKSWRRQQIDLFEQELARKEMHYIKQLEQMESQEARLHQLHKADTNLDETFI 1138
            :               |.|          |.||:..:||.|| |||.||   |.|....|::   
  Rat   850 Q---------------WGR----------ALKELARLKQREQ-ESQMAR---LKKQQEELEQ--- 882

  Fly  1139 SKIPNVSEVDYEAKFTELEEHIALLKSEMEE--QVRLFENRSRELRQENLQLYSEKTELKVRIAA 1201
                      ...::...||. ..:|:|.:|  .:|...||.|:..|:..|.|.|       ||:
  Rat   883 ----------MRLRYLAAEEK-DTVKTEQQELLDIRNELNRLRQQEQKQYQDYKE-------IAS 929

  Fly  1202 LEQQIGDLKAQGSDEGDLKEVLGELRSQHYRYNNLAREKELFRKRWRRSAKRVHALKLAMYERSL 1266
            .:|  |..:..|.:|| |.:.|          ..|..|::..             ::..:|    
  Rat   930 GKQ--GSPRGSGLEEG-LDDYL----------TRLIEERDTL-------------MRTGVY---- 964

  Fly  1267 EREHSNIRVEPID--LRKILTKDA 1288
              .|.:..:..:|  :|::|||::
  Rat   965 --NHEDRIISELDRQIREVLTKNS 986

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rhaNP_651390.2 DUF3668 158..386 CDD:289201 46/238 (19%)
Cep120NP_001178626.1 C2 9..114 CDD:301316 18/117 (15%)
DUF3668 118..340 CDD:289201 53/302 (18%)
C2 <531..564 CDD:175973 10/38 (26%)
CEP63 667..920 CDD:293650 83/413 (20%)
Peptidase_C19 703..928 CDD:271592 74/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMAG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5033
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.