DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rha and Cep120

Sequence 1:NP_651390.2 Gene:rha FlyBaseID:FBgn0027376 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_848801.2 Gene:Cep120 MGIID:2147298 Length:988 Species:Mus musculus

Alignment Length:1405 Identity:248/1406 (18%)
Similarity:440/1406 (31%) Gaps:569/1406 (40%)


  Fly    30 SDQVYCVLLHVVEAINFIGRDATDRQQIVMNAALNSVDFEVEGTQSEETIIFNSNCIWECDLAGI 94
            |||: .:::.::|..:|..|   .:..:|:.|..:......:.....:...|.:...||.|...:
Mouse     5 SDQL-LIVVSILEGRHFPKR---PKHLLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKVL 65

  Fly    95 KRLKTDHRPVKMTFYACRGGGAERKTIGTLLLPVRGLPVLGTVGSHNSPHLKMFWHKLICTSSEF 159
            .:.:....|:|:..:|.....:.::|:|.::|.:|     ....:..:|.    |::|:  |:::
Mouse    66 HQHRLQRTPIKLQCFALDPQTSAKETVGYIVLDLR-----TAQETKQAPK----WYQLL--SNKY 119

  Fly   160 RSHKPEVLLMLTIIKKSILHTKDFEHFMQFTEVKSPPTPPMQSPGHSITASMLQSQANVYVQSLV 224
            ...|.||.:.||:         :.:...|....|:...||..       ..:|.|.|.|..:.:|
Mouse   120 TKFKAEVQISLTL---------ETDTKAQVDSYKAKAAPPRD-------GKVLASLAGVDPKDIV 168

  Fly   225 QL-----GLLQVG-----NDPLVDCDIIEVVLQLKQLRNVTGLVKSLNQGKPPSSVILVFDFVGN 279
            .:     |..|:|     .||.:....|....||:||...|   ..|.:.:|  .....:..:||
Mouse   169 AVLNEEGGYHQIGPAEHCTDPFILSVTIAFATQLEQLIPCT---MKLPERQP--EFFFYYSLLGN 228

  Fly   280 -VTNIELKLNESDTYTLN---DVLGLRFKTSLRSMRLYFQRIFYLPINMYMNGTAIAHYRMDFTN 340
             |||...    ||....|   :...:|.::|:..:|:|......|.|::.....::....:....
Mouse   229 DVTNEPF----SDLINPNFEPERASVRIRSSVEILRVYLALHSKLQIHLCCGDQSLGSTEIPLNG 289

  Fly   341 LLPADDFFSDNRKYTSNGSFSFNRFGRTDSGREPKPPLMEYTFSVDLKTIFSRQEQEEPERT-PS 404
            ||             ..||...|:          .|..:|..|::|           .|.|. ..
Mouse   290 LL-------------KKGSTEINQ----------HPVTVEGAFTLD-----------PPNRAKQK 320

  Fly   405 IASGNLDSEDEQYLGQTFCASVVRSRLNLNESEETDEIASNVMKQLANDSETEVIEMKS-NTKNS 468
            :|...||      |..|...||...|..:                   ||:: :||:|: |...:
Mouse   321 LAPVPLD------LAPTVGVSVALQREGI-------------------DSQS-LIELKTQNGHEA 359

  Fly   469 KHN-----TSPQRKSQESKKLIRESSRNTRNSLENLQNVDELTSLDLFELEEKRQEK-------- 520
            :|:     |..:.|:....|..|||........:.....|:.|..::..|:..:..|        
Mouse   360 EHSQKRVLTPIKEKTLTGPKSPRESPAPPPPPNQTPPTKDDATESEVESLQYDKDPKPTVKGIGS 424

  Fly   521 ----IAELERIKAGQSESLLQTE------------LKVKKHKKADLELQ--------------GK 555
                :|:.| ...|.||.:...:            ..|......||||.              |.
Mouse   425 VPASLAQPE-ATCGASEVVTSGQKIAVPAASHHFCFSVDLRSVHDLELSFPVNCILRYSYPFFGS 488

  Fly   556 KSQLETINEVPPKSLRKSKPV-------------------------------------SQSELNN 583
            .:.:.|   .||..:||:..|                                     |:..|..
Mouse   489 AAPIMT---NPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKDKMSKDLLLG 550

  Fly   584 VPKIQ--------------------------ENLPILNNQTKGSRIQKENCEENNEDLSYALS-- 620
            |.:||                          |::|::..|...:||.         ||||.::  
Mouse   551 VARIQLSNILSSEKTRFLGANGEQCWRQTYSESVPVIAAQGSNNRIL---------DLSYTMTLE 606

  Fly   621 ------------EEHSSSNEKLDKKPGASKTMRPPEHVDTDLETDISVFSIQKKRKSKSKLVISN 673
                        .|.|.....:|:||.:     ||                              
Mouse   607 DYGLVKMREIFVSESSQGVPAVDQKPSS-----PP------------------------------ 636

  Fly   674 ELHNFEDSSTDTLEKGRPNPSKGDLKLRARWVEVNKVQTQALIETEKFLQKTCPAELDEVLYEDQ 738
                             |.|...::::..|    ..::.:|.:|.|.:      .|:.|.::|.|
Mouse   637 -----------------PAPCPSEIQMEPR----ETLEYKAALELEMW------KEMQEDIFESQ 674

  Fly   739 VALGQAKTSKPTKRKVKKPEEDKVKRIDYETSYEEEITFCHPEKDPMTMIGENPINLNDLASSEE 803
            :...:....:....:.||.:.::      |:..::::.                          |
Mouse   675 LKQKELAHMQALAEEWKKRDRER------ESLVKKKVA--------------------------E 707

  Fly   804 YISISEGNSKPAEIVYTETEQRVTFVNPKRDREKKKLSSLSKDDLLVEVRSEEYINLRSSARSKT 868
            | ||.||..:.|.......||::.....:..||:|:| .|.::..|.|::.       |..|::.
Mouse   708 Y-SILEGKLQKALTELETREQQLASAEAELQRERKEL-QLERERNLQELQD-------SVRRARD 763

  Fly   869 DCVRKKKKISIHEDQVYQAELTPSEEPSSQSESRGTDNANPITDQPQVDRVKKKKRDTSGDQQLF 933
            ||             |||.||                           :|:|.|:          
Mouse   764 DC-------------VYQVEL---------------------------ERLKLKQ---------- 778

  Fly   934 HVEYTSSQKSISKTEGNVKCKELIEPDVEQTDVQVLKKKKLKKTLVTNDTVAQDYETLEEETIKP 998
                                   :|.|          |::|::.|  || ....|:|||:|    
Mouse   779 -----------------------LEED----------KQRLQQQL--ND-AGNKYKTLEKE---- 803

  Fly   999 VKKKIVRKKSSVILEKIEDTENKGPADEVVSVEAKKIIKKKAKPACDNPTVEEYPKTKKGESRKL 1063
                         .::.:|.:|..|...:.| |...:            |:|:....:|.||   
Mouse   804 -------------FQQFKDQQNNKPEIRLQS-EINLL------------TLEKVELERKLES--- 839

  Fly  1064 KSTSKEHFTMEKPSSTIDSIGQKIKSWRRQQIDLFEQELARKEMHYIKQLEQMESQEARLHQLHK 1128
            .:.||.|:..:               |.|          |.||:..:||.|| |||.|||.:..:
Mouse   840 ATKSKLHYKQQ---------------WGR----------ALKELARLKQREQ-ESQMARLKKQQE 878

  Fly  1129 ADTNLDETFISKIPNVSEVDYEAKFTELEE-HIALLKSEMEEQVRL-------FENRSRELRQEN 1185
                                      |||: .:..|.:|.:|.||.       ..|....|||:.
Mouse   879 --------------------------ELEQMRLRYLAAEEKETVRTEQQELLDIRNELNRLRQQE 917

  Fly  1186 LQLYSEKTELKVRIAALEQQIGDLKAQGSDEGDLKEVLGELRSQHYRYNNLAREKELFRKRWRRS 1250
            ...|.:..|:      ...::|..:..|.:|| |.:.|          ..|..|::..       
Mouse   918 QNQYQDCKEI------ASGKLGSPRGSGLEEG-LDDYL----------TRLIEERDTL------- 958

  Fly  1251 AKRVHALKLAMYERSLEREHSNIRVEPID--LRKILTKDA 1288
                  ::..:|      .|.:..:..:|  :|::|||::
Mouse   959 ------MRTGVY------NHEDRIISELDRQIREVLTKNS 986

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rhaNP_651390.2 DUF3668 158..386 CDD:289201 49/242 (20%)
Cep120NP_848801.2 C2 9..114 CDD:301316 18/117 (15%)
DUF3668 118..340 CDD:289201 59/287 (21%)
C2 <533..566 CDD:175973 5/33 (15%)
CEP63 667..920 CDD:293650 86/465 (18%)
DASH_Spc19 <711..791 CDD:285487 29/173 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMAG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5127
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.