DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rha and CEP120

Sequence 1:NP_651390.2 Gene:rha FlyBaseID:FBgn0027376 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_694955.2 Gene:CEP120 HGNCID:26690 Length:986 Species:Homo sapiens

Alignment Length:1375 Identity:249/1376 (18%)
Similarity:454/1376 (33%) Gaps:516/1376 (38%)


  Fly    30 SDQVYCVLLHVVEAINFIGRDATDRQQIVMNAALNSVDFEVEGTQSEETIIFNSNCIWECDLAGI 94
            |||: .:::.::|..:|..|   .:..:|:.|..:......:.....:...|.:...||.|...:
Human     5 SDQL-LIVVSILEGRHFPKR---PKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKAL 65

  Fly    95 KRLKTDHRPVKMTFYACRGGGAERKTIGTLLLPVRGLPVLGTVGSHNSPHLKMFWHKLICTSSEF 159
            .:.:....|:|:..:|.....:.::|||.::|.:|     ....:..:|.    |::|:  |:::
Human    66 HQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLR-----TAQETKQAPK----WYQLL--SNKY 119

  Fly   160 RSHKPEVLLMLTIIKKSILHTKDFEHFMQFTEVKSP-------PTPPMQSPGHSITA-------- 209
            ...|.|:.:.:.:                .|:.|.|       ..||......:|.|        
Human   120 TKFKSEIQISIAL----------------ETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIV 168

  Fly   210 SMLQSQANVYVQSLVQLGLLQVGNDPLVDCDIIEVVLQLKQLRNVTGLVKSLNQGKPPSSVILVF 274
            ::|..:...:     |:|..:...|..:....|....||:||...|   ..|.:.:|  .....:
Human   169 AVLNEEGGYH-----QIGPAEYCTDSFIMSVTIAFATQLEQLIPCT---MKLPERQP--EFFFYY 223

  Fly   275 DFVGN-VTNIELKLNESDTYTLNDVL---------GLRFKTSLRSMRLYFQRIFYLPINMYMNGT 329
            ..:|| |||          ...||::         .:|.::|:..:|:|......|.|::.....
Human   224 SLLGNDVTN----------EPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQ 278

  Fly   330 AIAHYRMDFTNLLPADDFFSDNRKYTSNGSFSFNRFGRTDSGREPKPPLMEYTFSV--------- 385
            ::....:..|.||.......:....|..|:|:.:...|......|.|..:..|..|         
Human   279 SLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGI 343

  Fly   386 ------DLKTIFSRQEQEEPER------TPSIASGNLDSEDEQYLG-QTFCASVVRSRLNLNESE 437
                  :|||    |.:.|||.      ||        .:::...| ::...|.|.|.   |:|.
Human   344 DSQSLIELKT----QNEHEPEHSKKKVLTP--------IKEKTLTGPKSPTVSPVPSH---NQSP 393

  Fly   438 ETDEIASNVMKQLANDSETEVIEMKSNTK-NSKHNTS-PQRKSQESKKLIRESSRNTRNSLENLQ 500
            .|        |..|.:||.|.::...:|| |.|.::| |...:|                |....
Human   394 PT--------KDDATESEVESLQYDKDTKPNPKASSSVPASLAQ----------------LVTTS 434

  Fly   501 NVDELTSLDLFELEEKRQEKIA------------ELERIKA------------------GQSESL 535
            |..|:.|          .:|||            :|..|.|                  |.:..:
Human   435 NASEVAS----------GQKIAVPATSHHFCFSIDLRSIHALEIGFPINCILRYSYPFFGSAAPI 489

  Fly   536 L-QTELKVKKHKKADL--------------ELQGKKSQLETINEVPPKSLRKSKP----VSQSEL 581
            : ...::|:|:.:..|              :||....::..:.|:..|. :.||.    :::.:|
Human   490 MTNPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFLRIPLLVELWHKD-KMSKDLLLGIARIQL 553

  Fly   582 NNV------------------PKIQENLPILNNQTKGSRIQKENCEENNEDLSYALSEEHSSSNE 628
            :|:                  ....|::|::..|...:||         .||||.::.|..    
Human   554 SNILSSEKTRFLGSNGEQCWRQTYSESVPVIAAQGSNNRI---------ADLSYTVTLEDY---- 605

  Fly   629 KLDKKPGASKTMRPPEHVDTDLETDISVFSIQKKRKSKSKLVISNELHNFEDSSTDTLEKGRPNP 693
                  |..| ||  |...:|....:|  ::|:|..|..                       |.|
Human   606 ------GLVK-MR--EIFISDSSQGVS--AVQQKPSSLP-----------------------PAP 636

  Fly   694 SKGDLKLRARWVEVNKVQTQALIETEKFLQKTCPAELDEVLYEDQVALGQAKTSKPTKRKVKKPE 758
            ...:::...|    ..::.:|.:|.|.:      .|:.|.::|:|:...:....:....:.||.:
Human   637 CPSEIQTEPR----ETLEYKAALELEMW------KEMQEDIFENQLKQKELAHMQALAEEWKKRD 691

  Fly   759 EDKVKRIDYETSYEEEITFCHPEKDPMTMIGENPINLNDLASSEEYISISEGNSKPAEIVYTETE 823
            .::      |:..::::.                          || :|.||..:...|...:.|
Human   692 RER------ESLVKKKVA--------------------------EY-TILEGKLQKTLIDLEKRE 723

  Fly   824 QRVTFVNPKRDREKKKLSSLSKDDLLVEVRSEEYINLRSSARSKTDCVRKKKKISIHEDQVYQAE 888
            |::..|..:..||||            |::||...||    :...|.:|:.|     ||.::|.|
Human   724 QQLASVESELQREKK------------ELQSERQRNL----QELQDSIRRAK-----EDCIHQVE 767

  Fly   889 LTPSEEPSSQSESRGTDNANPITDQPQVDRVKKKKRDTSGDQQLFHVEYTSSQKSISKTEGNVKC 953
            |                           :|:|.|:                              
Human   768 L---------------------------ERLKIKQ------------------------------ 775

  Fly   954 KELIEPDVEQTDVQVLKKKKLKKTLVTNDTVAQDYETLEEETIKPVKKKIVRKKSSVILEKIEDT 1018
               :|.|          |.:|::.|  || ....|:.||:|                 .::.:|.
Human   776 ---LEED----------KHRLQQQL--ND-AENKYKILEKE-----------------FQQFKDQ 807

  Fly  1019 ENKGPADEVVSVEAKKIIKKKAKPACDNPTVEEYPKTKKGESRKLKSTSKEHFTMEKPSSTIDSI 1083
            :|..|...:.| |...:            |:|:....:|.||   .:.||.|:..:         
Human   808 QNNKPEIRLQS-EINLL------------TLEKVELERKLES---ATKSKLHYKQQ--------- 847

  Fly  1084 GQKIKSWRRQQIDLFEQELARKEMHYIKQLEQMESQEARLHQLHKADTNLDETFISKIPNVSEVD 1148
                  |.|          |.||:..:||.|| |||.||   |.|....|::             
Human   848 ------WGR----------ALKELARLKQREQ-ESQMAR---LKKQQEELEQ------------- 879

  Fly  1149 YEAKFTELEEHIALLKSEMEEQVRLFENRSRELRQENLQLYSEKTELKVRIAALEQQIGDLKAQG 1213
            ...::...||. ..:|:|.:|.:.: .|....|||:..:.|.:.||:               |.|
Human   880 MRLRYLAAEEK-DTVKTERQELLDI-RNELNRLRQQEQKQYQDSTEI---------------ASG 927

  Fly  1214 SDEGDLKEVLGELRSQHYRYNNLAREKELFRKRWRRSAKRVHALKLAMYERSLEREHSNIRVEPI 1278
            ..:|....||.|....:  ...|..|::..             ::..:|      .|.:..:..:
Human   928 KKDGPHGSVLEEGLDDY--LTRLIEERDTL-------------MRTGVY------NHEDRIISEL 971

  Fly  1279 D--LRKILTK 1286
            |  :|:||.|
Human   972 DRQIREILAK 981

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rhaNP_651390.2 DUF3668 158..386 CDD:289201 45/268 (17%)
CEP120NP_694955.2 C2 9..114 CDD:326325 19/117 (16%)
DUF3668 118..340 CDD:315149 45/258 (17%)
SMC_N <640..917 CDD:330553 90/491 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMAG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.