DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rha and cep120

Sequence 1:NP_651390.2 Gene:rha FlyBaseID:FBgn0027376 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_017212877.1 Gene:cep120 ID: Length:999 Species:Danio rerio

Alignment Length:1269 Identity:227/1270 (18%)
Similarity:438/1270 (34%) Gaps:364/1270 (29%)


  Fly    25 VSSKDSDQVYCVLLHVVEAINFIGRDATDRQQIVMNAALNSVDFEVEGTQSEETIIFNSNCIWEC 89
            ::|| |:|: .:::.::|...|   ..:.|..:|:.|..:......:..:.:|...|.:...||.
Zfish     1 MASK-SEQL-LIVVSILEGRQF---PRSPRLSLVVEARFDGETLSTDPVEHKEQPQFCTELAWEL 60

  Fly    90 DLAGIKRLKTDHRPVKMTFYACRGGGAERKTIGTLLLPVRGLPVLGTVGSHNSPHLKMFWHKLIC 154
            |...:.:.:....|:|:..||.....:.|:::|.::|.:|.:..:     ..:|.    ||.|: 
Zfish    61 DRRTLHQHRLQRTPIKLQCYAVDSSTSARESVGYIVLDLRSVQEI-----KQAPK----WHPLL- 115

  Fly   155 TSSEFRSHKPEVLLMLTIIKKSILHTKDFEHFMQFTEVKSPPTP--PMQSPGHSITASMLQSQAN 217
             ||::...||.:|:.:      ||...:.:....|...|:||.|  |...|   :.|..|::..|
Zfish   116 -SSKYTKLKPALLIGM------ILENDNKQTAETFKAKKAPPRPGSPALLP---LDAEKLKAVLN 170

  Fly   218 VYVQSLVQLGLLQVG-NDPLVDCDIIEVVL----QLKQLRNVTGLVKSLNQGKPPSSVILVFDFV 277
                  .:.|..|:| .|...:..::.|.:    :|:||  ::...|..::|   |.....:..:
Zfish   171 ------EEEGFHQIGPADVCAEMFVLSVTVAFATKLEQL--ISSSAKLSSEG---SEFFFYYTLL 224

  Fly   278 GNVTNIELKLNESDTYTLNDVLGLRFKTSLRSMRLYFQRIFYLPINMYMNGTAIAHYRMDFTNLL 342
            ||....|...|........:...:|.::|...:||:|.:...|.|::.....::....:....|:
Zfish   225 GNDVTSEPFQNLLSPNFEPERASVRIRSSEPVLRLFFSQQPCLQIHLCCGNQSLGSTDISLAGLI 289

  Fly   343 PADDFFSDNRKY--TSNGSFSFNRFGRTDSGREPKPPLMEYT--FSVDLKTIFSRQEQEEPERTP 403
            .:.   ||..|:  |..|:|......|:....:..|..::.|  .||.|:              |
Zfish   290 KSS---SDLNKHSCTIEGAFILQPPNRSKPSLQTVPAELQPTVGISVTLR--------------P 337

  Fly   404 SIASGNLDSEDEQYLGQTFCASVVRSRLNLNESEETDEIASNVMKQLANDSETEVIEMKSNTKNS 468
            ...:..||...|..|.    ..|.:.|:.....||...:.|           ...:....:..:.
Zfish   338 EDVNNQLDMPTENGLK----TPVKKGRVPAGRQEECVSLRS-----------PSALSRSPDPPHR 387

  Fly   469 KHNTSPQRKSQESKKLIRESSRNTRNSLENLQNVDELTSLDLFELEEKRQEKIAELERIKAGQSE 533
            ..:|||:.:..||                                                 ::|
Zfish   388 SPHTSPEHRHSES-------------------------------------------------EAE 403

  Fly   534 SL---LQTELKVKKHKKADLELQGKKSQLETINEVPPKS-LRKSKPVSQSELNNVPKIQENLPIL 594
            ||   :........|::|...|..:        ..||.: .|.:.|:|...|  .|....::|.:
Zfish   404 SLSGDVTQAPPTAHHRQASPTLHDR--------HAPPTTHQRLAPPISDDRL--APPTTHDVPDV 458

  Fly   595 NNQTKGSRIQKENCEENNEDLSYALSEEHSSSNEKLDKKPGASKTMRPPEHVDTDLETDISVFSI 659
            ..:|          |.:..|.|.::|               |.|...|..........|:.  ||
Zfish   459 LVRT----------EADAADSSVSVS---------------APKISIPASAHHFCFSLDLR--SI 496

  Fly   660 QKKRKSKSKLVISNELHNFEDSSTDTLEKGRPNPSKGDLKLRARWVEVNKVQTQALIETEKFL-Q 723
            :..|.|..........:.|..|:...:    .:|:          |||.|       .||.|| |
Zfish   497 RDLRTSSPVNCYLRYAYQFFGSAAPIM----TSPA----------VEVKK-------STEVFLPQ 540

  Fly   724 KTCPAELDEVLYEDQVALGQAKTSKPTKRKVKKPEEDKVKRIDYETSYEEEITFCHPEKDPMT-- 786
            ..|  ..|.....:|:                   :|...|:..      .:...|  ::|.:  
Zfish   541 SYC--AFDFAALPNQL-------------------QDTFLRVPL------LVEMWH--REPGSGD 576

  Fly   787 -MIGENPINLNDLASSEEY--------------------ISISEGNSKPAEIVYTETEQRVTFVN 830
             ::|...|.|:.|.|||:.                    |..::|:.|.||:.|....:.:.||.
Zfish   577 VLLGSVSILLSRLLSSEKTRFLDASGRQHWRRSCTERVPIRTADGSEKLAELCYVAVLEDLGFVK 641

  Fly   831 PKRDREKKKLSSLSKDDLLV--------------EVRSEEYINLRSSARSKTDC---VRKKKKIS 878
            .:              |:||              |..||.....|.:...|...   :.|:.:..
Zfish   642 TQ--------------DILVSESSQGPSAAAAPPEGPSETLTRPRETLEYKAALELEMWKEMQED 692

  Fly   879 IHEDQVYQAELTPSEEPSSQSESRGTDNANPITDQPQVDRVKKKKRDTSGDQQLFHVEYTSSQKS 943
            :.::|:.|.||...:..:.:...|         |..:...:|||:           :|::..::.
Zfish   693 LFDNQLKQKELNHMQALAEEWRKR---------DHQREALIKKKE-----------LEFSLLEEQ 737

  Fly   944 ISKTEGNVKCKE--LIEPDVE----QTDVQVLKKKKLKKTLVTNDTVAQDYE---TLEEETIKPV 999
            :.||..:::.:|  |...::|    |.:::...:..|::...:...:.:|.:   .|:...:..:
Zfish   738 LQKTLADLELREKALAHAEMETQRLQRELRCEHELSLRELQDSGRRLREDCQHQLELQRAKVTQL 802

  Fly  1000 KKKIVRKKSSVILEKIEDTENKGPADEVVSVEAKKIIKKKAKPACDNPTVEEYPKTKKGESRKLK 1064
            :.::.|::     ::.::.|:|           .:.::|:.:...|..:|.  |:.:......|.
Zfish   803 EDQLTRQR-----QQTQEAESK-----------HRQLEKEFQQFRDQQSVR--PEARLQSEINLL 849

  Fly  1065 STSKEHFTMEKPSSTIDSIGQKIKSWRRQQIDLFEQELARKEMHYIKQLEQMESQEARLHQLHKA 1129
            :..|.....:..|:|...:..| :.|.|          |.||:...||.|    ||:.|.:|.|.
Zfish   850 TLEKVELERKLESATKSKLHYK-QQWGR----------ALKELARFKQRE----QESALCRLKKQ 899

  Fly  1130 DTNLD------------ETFISKIPNVSEVDYEAKFTELEE----------HIALLKSEMEEQVR 1172
            ...||            ||..|....:.::..:....:.:|          .:.:.:|..|...|
Zfish   900 QQELDQMRLRFLAAEEKETVKSDKQELQDIRNQLNRLKQQEDPPRGWTDAAQVCVTESADEHVTR 964

  Fly  1173 LFENRSRELRQENLQLYSEKTELKVRIAALEQQI 1206
            |.|.|...||   ..:|:....:   ||.|::||
Zfish   965 LLEERDTLLR---TGVYTHHDRI---IAELDRQI 992

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rhaNP_651390.2 DUF3668 158..386 CDD:289201 49/239 (21%)
cep120XP_017212877.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMAG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007279
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.