DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rha and cep120

Sequence 1:NP_651390.2 Gene:rha FlyBaseID:FBgn0027376 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001120380.1 Gene:cep120 XenbaseID:XB-GENE-5872143 Length:882 Species:Xenopus tropicalis

Alignment Length:1233 Identity:240/1234 (19%)
Similarity:423/1234 (34%) Gaps:393/1234 (32%)


  Fly    30 SDQVYCVLLHVVEAINFIGRDATDRQQIVMNAALNSVDFEVEGTQSEETIIFNSNCIWECDLAGI 94
            |||: .:::.::|..:|..|   .|..:|::|..:......:.....|...|.:...||.|...:
 Frog     5 SDQL-LIVVSILEGRHFPKR---SRHMLVIDAKFDGEQLSTDPVPHLEQPQFATELAWELDRKTL 65

  Fly    95 KRLKTDHRPVKMTFYACRGGGAERKTIGTLLLPVRGLPVLGTVGSHNSPHLKMFWHKLICTSSEF 159
            .:.:....|:|:..:|.....:.::::|.::|.:|     .......:|.    |:.|:  ||::
 Frog    66 HQHRLQRTPIKLQCFALDTLTSAKESVGYVVLDLR-----AAQEKKQAPK----WYSLL--SSKY 119

  Fly   160 RSHKPEVLLMLTIIKKSILHTKDFEHFMQFTEVKSPPTPPMQS--PGHSITASMLQSQANVYVQS 222
            ...|||:.|.:::         :.::.......|:...||.:|  ||         ..|.:..:|
 Frog   120 TKFKPEIQLNISL---------ETDNKPAVDTFKAKEAPPRRSKVPG---------DLAGLEPKS 166

  Fly   223 LVQL-----GLLQVG-----NDPLVDCDIIEVVLQLKQLRNVTGLVKSLNQGKPPSSVILVFDFV 277
            ||.:     |..|:|     .|..|....|....||:||     :..:|...:|.......:..:
 Frog   167 LVPILNEAEGYHQIGPAEYCKDYFVLSVTIAFATQLEQL-----IPSTLRLPEPQPEFFFYYSLL 226

  Fly   278 GN-VTNIELKLNESDTYTLN-----DVLGLRFKTSLRSMRLYFQRIFYLPINMYMNGTAIAHYRM 336
            || ||      ||..|..:|     :...:|.::|...:.:|......|.|::.....::....:
 Frog   227 GNDVT------NEPFTDLINPEFEPERASVRIRSSKEVLCMYLSVQPKLQIHLCCGDQSLGSTDI 285

  Fly   337 DFTNLLPADDFFSDNRKYTSNGSFSFNRFGRTDSGREPKPPLMEYTF--SVDLKTIFSRQEQEEP 399
            ..|.||.......::......|:|......|........|..|..|.  |:.|:.....|....|
 Frog   286 ALTGLLNKASVEIEHHPVVVEGAFILTPPNRAKQNLSAVPLEMSPTIGVSIALQKEIGLQSVHHP 350

  Fly   400 ERTPSIASGNLDSEDEQYLGQTFCASVVRSRLNLNESEETDEIASNVMKQLANDSETEVIEMKSN 464
            :..|                               :|...:|:.:..:|:.||..|         
 Frog   351 KEQP-------------------------------QSVAAEEVPTTPLKKSANLKE--------- 375

  Fly   465 TKNSKHNTSPQRKSQESKKLIRESSRNTRNSLENLQNVDELTSLDLFELEEKRQEKIAELERIKA 529
                     ..|.....|.|:...|..|:         ||.|.              :|.|.|| 
 Frog   376 ---------GARSPPPPKPLMFSDSPPTK---------DEATE--------------SEAESIK- 407

  Fly   530 GQSESLLQTELKVKKHKKADLELQGKKSQLETINEVPPKSLRKSKPVSQSELNNVPKIQENLPIL 594
                |..|.|..:.|                      |.:..||.|:|:..|:            
 Frog   408 ----SDFQAEPPLSK----------------------PLTRSKSPPLSEPPLS------------ 434

  Fly   595 NNQTKGSRIQKENCEENNEDLS-YALSEEHSSSNEKLDKKPGA-----SKTMRPPEHVDTDLETD 653
                 ||     :|....:.:| .|.:...|||.:|:...|.|     :..:|...:||.....:
 Frog   435 -----GS-----HCPTPIQGVSAIAKNTSESSSAQKITVPPAAHHFCFTIDLRSIRNVDVGFPVN 489

  Fly   654 ISVFSIQKKRKSKSKLVISNELHNFEDSSTDTLEKGRPNPSKGDLKLRARWVEVNKVQTQALIET 718
                            .|....:.|..|:...:    .||.          |||.|       ..
 Frog   490 ----------------CILRYSYPFFGSAAPIM----TNPP----------VEVQK-------NM 517

  Fly   719 EKFL-QKTCPAELDEVLYEDQVALGQAKTSKPTKRKVKKPEEDKVKRIDYETSYEEEITFCHPEK 782
            |.|| |..|..:...:.::.|                     |...|:..      .:...|  |
 Frog   518 EVFLPQSYCAFDFATLPHQIQ---------------------DTFLRLPL------LVELWH--K 553

  Fly   783 DPMT---MIGENPINLNDLASSEEYISISEGNSKPAEIVYTETEQRVTFVNPKRDREKKKLSSLS 844
            |.||   :||...|.|:::.|||:...:.....:.....::|   |:|..  ..:..|.|::.||
 Frog   554 DKMTKDLLIGVTKIQLSNVLSSEKTRFLGPHGDQCWRQTFSE---RITVT--AVEGSKNKVAELS 613

  Fly   845 -----KDDLLVEVRSEEYINLRSSARSKTDCVRKKKKISIHEDQVYQAELTPSEEPSSQSESRGT 904
                 :|..||:||                                  |:..||...|..:.:|:
 Frog   614 YIITLEDYGLVKVR----------------------------------EVVVSESSQSTGQEKGS 644

  Fly   905 DNANPITDQPQVDRVKKKKRDTSGDQQLFHVEYTSSQKSISKTEGNVKCKELIEPDVEQTDVQVL 969
            ..|..:    |......:.|:|        :||    |:..:.|   ..||:      |.|:.|.
 Frog   645 LPAQTL----QSTAPLPEPRET--------LEY----KAALELE---MWKEM------QEDLFVN 684

  Fly   970 KKKKLKKTLVTNDTVAQDYETLEEETIKPVKKKIVRKKSSVILEKIEDTENKGPADEVVSVEAKK 1034
            :.|  ||.||....:|::::..::|....||||:.  :.:|:.|:::    |..||         
 Frog   685 QLK--KKELVHMQALAEEWKRRDKEREALVKKKVA--EYTVLEEQLQ----KALAD--------- 732

  Fly  1035 IIKKKAKPACDNPTVEEYPKTKKGESRKLKSTSKEHFTMEKPSSTIDSIGQKIKSWRRQQIDLFE 1099
             ::|:.:...::          :.|.:|||  ::.....|:      ||.::..|.||.:.|...
 Frog   733 -LEKRERQLAND----------EMELKKLK--AQMQLDCER------SIQERQDSIRRVREDCMH 778

  Fly  1100 Q-ELARKEMHYIKQLEQMESQEARLHQLHKADTNLDETFISKIPNVSEVDYEAKFTELEEHIALL 1163
            | ||.|      .:.:|:|..:.||.|..:.:..|:.|..||:      .|:.::....:.:|.|
 Frog   779 QIELER------SKAKQLEEDKLRLQQQVELERKLESTTKSKL------HYKQQWGRALKELARL 831

  Fly  1164 KSEMEEQVRLFENRSRELRQENLQLYSEKTELKVRIAALEQQIGDLKAQGSDEGDLKEVLGEL 1226
            |  ..||    ||....|:::..:|  |...|:. :||.|:.:...:.|     :|:|:..||
 Frog   832 K--QREQ----ENAMARLKKQQQEL--EHMRLRY-LAAEEKDVVKTERQ-----ELEEIRNEL 880

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rhaNP_651390.2 DUF3668 158..386 CDD:289201 49/248 (20%)
cep120NP_001120380.1 DUF3668 118..340 CDD:289201 50/251 (20%)
C2 <522..>588 CDD:301316 17/95 (18%)
CENP-F_leu_zip 697..850 CDD:287450 45/205 (22%)
DUF4200 711..809 CDD:290574 31/138 (22%)
GBP_C <779..877 CDD:303769 31/124 (25%)
coiled coil 839..850 CDD:293879 1/11 (9%)
coiled coil 866..877 CDD:293879 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CMAG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007279
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.