DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG11892

DIOPT Version :8

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651372.1 Gene:CG11892 / 43053 FlyBaseID:FBgn0039313 Length:439 Species:Drosophila melanogaster

Alignment Length:420 Identity:108/421 (26%)
Similarity:188/421 (45%) Gaps:52/421 (12%)


  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIKFVPTS-AISKGENYLTIVLRIQIEMQLKDNSIEDVSYILK 70
            |:|:|:......|.:..::....|.:|..: |:.|||||..::.|::.:....|.|.:...||:|
  Fly    34 PEWLTESYLQDALRKYYKDQLIRINWVKVNPALGKGENYGGVLTRVKAQFTRSDGSSQLGHYIVK 98

  Fly    71 IPLVPEDEKNDF-------HEMFDAELDMYDHLIP----------ELEDLYAKNTSISPKFKPVH 118
            ...    |.|:|       :::|:.|:.:|:.::|          :.|.::|:..::.       
  Fly    99 STF----EGNEFAQNAMKPYDIFNREMIIYEQVLPKQKALLREIGDAEQIFAETMAVD------- 152

  Fly   119 LKFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDI 183
                   :.:..::.|||..:|:...||..||:|.....||:|||:.||.||    .|.|.|..|
  Fly   153 -------IDNSALIFEDLNARGFVMPDRLVGLDQKLARIVLRKLAKMHATSA----VLNERENHI 206

  Fly   184 RESYFTTEHQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQ---LTDLNIEFGKN---- 241
            .|||    .:...:.:..|:...|:..:|.......|......|..:   |..:.:|.||.    
  Fly   207 LESY----DRGFFNRYTDNYEPAFVGMLQAATRRVAQWPGYEKYAEKLKALVPIYMELGKRIFDI 267

  Fly   242 DPLELSVLNHGDFWCNNFMFKY-KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDK 305
            .|..::||.|||.|.||.:.|| |...|..||..:|||...:|:||.||...:.:|.:|.:..:.
  Fly   268 SPGHINVLAHGDLWTNNVLVKYDKQTGEPIDVVIIDFQYTAWGSPALDLFYFMNSSLEFDLHQNH 332

  Fly   306 FDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGN 370
            .:..|.||.:...:.|..|.|....|:|.:||..|.:...:|...:..:.|:.......|:....
  Fly   333 QEQLIAYYFRHFADTLKKLQYRSTIPSLHQFHQQLQQKKFYAAHTSISVFPVQRNVETADADFNA 397

  Fly   371 VMGNSEEAIAFKRKMFLLPAYVDQIKVILP 400
            :|.|::.|:.||...:..|.....::.:||
  Fly   398 LMENNQRAMNFKDACYRNPIAQRILRELLP 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 84/311 (27%)
CG11892NP_651372.1 EcKinase 68..353 CDD:281023 84/311 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55820
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.