DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG11878

DIOPT Version :8

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster

Alignment Length:434 Identity:110/435 (25%)
Similarity:192/435 (44%) Gaps:43/435 (10%)


  Fly     1 MTDQ------PTPQWVTKELFSSLLEQSNRNFKAIIKFVPTS-AISKGENYLTIVLRIQIEMQLK 58
            ||::      |.|.|:|.|.....|....::....:..:.|. |::.|.||.:::.||.:|...|
  Fly     1 MTEKSTHKVHPAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTK 65

  Fly    59 -DNSIEDVSYILKIPLVPEDEKND---FHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHL 119
             ....:..::::|......|...|   .:.::..|:|:|:|::|:|.|:..|....|.|.....:
  Fly    66 VSKGKQSTTFLVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATM 130

  Fly   120 KFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAAS---AKRVVELGEYEK 181
            ....|   .|.|:.||:....|:.|.|.:.|:......||:|||.:||||   |:|  :.|.::|
  Fly   131 NVDRE---RDSIIFEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAER--QPGIFDK 190

  Fly   182 DIRESYFTTEHQKLLDEFNINFCMPFLECM-----------QQYNLEPGQLV-LISDYTSQLTDL 234
            :....:| .:|.:.......|    .||.:           |:|..:..:|| .:.||..:.|  
  Fly   191 NYDRGFF-NKHTRAYAPIMTN----LLEALSRSLASDEELGQRYKAKIDRLVERLMDYGERST-- 248

  Fly   235 NIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKF 299
                 .:.|.:...|.|||.|..||||:|.......:..|:|||...:.:||.||.....||.:.
  Fly   249 -----TSSPGDFLTLAHGDLWTTNFMFQYDAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQD 308

  Fly   300 SIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDV 364
            :::|:.....:::|:.:|.|.|..|.|....|:|..|.........:|..|:....|::......
  Fly   309 NLRLEHQTELVQFYYYRLTEALRKLKYAGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKE 373

  Fly   365 DSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408
            |:.|..|:.:||..:.||..::.......::.|.||:|...|.:
  Fly   374 DASIEQVLSSSESGMRFKNSVYESENIKKKLSVTLPFLDQFGLL 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 81/305 (27%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 81/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55816
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.