DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG18765

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster

Alignment Length:431 Identity:115/432 (27%)
Similarity:195/432 (45%) Gaps:63/432 (15%)


  Fly     1 MTAETGTAPMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIM----LRLKLEVE 61
            :|.::..|.:|||:.....|.|:.:        |..|:....|:  ..:.|.:    |.:.::|.
  Fly     7 VTQQSQDASLPTWVEKKELEALVKQ--------ISEFRKIESLR--WKWETQLAEPALCVHIQVL 61

  Fly    62 LQDHTIENVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFG----- 121
            :.|:....|||::|:|....:..::.|..: |:.||.:|..|:|.||::|::....|.||     
  Fly    62 VADNKKRQVSYLIKSPETVPVGLKLPRTGD-FSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQ 125

  Fly   122 AKAYEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNY 186
            ||........||:|.:     |:...:.|:||.:...:.||.|:|.:||.:|..| .|.|.....
  Fly   126 AKLKSSHIYGDYILNK-----GYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYI-AKTPGKIRE 184

  Fly   187 LQPTYADTMKESIEQVAETLGKYFLKCLPLYEG--------YEEYSAAVHKMQPKIVDLMYAMNT 243
            | |...:..| |.|:.||....|.|:   .:|.        ||:...:..|......:::.:..:
  Fly   185 L-PKLRENSK-SDEETAELKSLYQLR---FHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKTS 244

  Fly   244 PDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLS 308
                 ||.:.:|.||.:|::.:. |......:|.|......:.....|||...||  |....:.|
  Fly   245 -----FNVILNGSCWPNNLLLQV-DAFGNVKDTLFSGFHTAQYGPAVYDLFSSLL--TAPAEKSS 301

  Fly   309 QFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANL 373
            :||.::|:|||.|:|:|.:|.: ..|.|:|..|...|||||...:..|..:.|.|         |
  Fly   302 RFDGYVKFYHDQLIENLNLLKF-LGKKPSLTDLQLDLLKYGHWAFETATEILPIV---------L 356

  Fly   374 TDFVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRGAFQ 414
            :||    .|.|..:|  :.|..:.:.:..:|.|:.|||.|:
  Fly   357 SDF----GNNDIEEL--FRNPVFGEQIRELLPWMENRGYFE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 80/302 (26%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 78/287 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131026406
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.