DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG11893

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster

Alignment Length:423 Identity:85/424 (20%)
Similarity:166/424 (39%) Gaps:47/424 (11%)


  Fly    11 PTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSY--- 72
            |.||.|....::|..........:...|.......|::|:::|.|...|     :|.....:   
  Fly    18 PAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAE-----YTTSKGKFCKP 77

  Fly    73 -MLKTPYDFEMY-REILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVK-FGAKAYEIDAPDDYV 134
             ::||..:.|.: :::|..:::|:.|.:.:.:.:||.|::.::.|.:.| |....|....|...:
  Fly    78 LIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVL 142

  Fly   135 LLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESI 199
            :.:||.|.|: .|.|...::|...|.|..|:|:|||||...::         .||......|..:
  Fly   143 IFEDLVPQGY-FVIRDRPINMNEYKNVFSKLAKWHAVSMKVLN---------EQPDILKDFKYGL 197

  Fly   200 EQVAETLG--------KYFLKCLPLYEGYEEYSAAVHKMQPKIVDLM------YAMNTPDPQDFN 250
            .::...:.        ..|||.:.......:|.....|::...:..|      |..|. ....:.
  Fly   198 MEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNV-QSDGYY 261

  Fly   251 ALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIK 315
            .:.|||....|:||...:      |..|||.|:..:..:..||.|.:....:.|.:.......|.
  Fly   262 VMCHGDFHGRNMMFNKNE------EVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLIN 320

  Fly   316 YYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTET 380
            :|...|.:.|:.:.| :.|.||...|..|:.::....:.:.....|.::..:.....:.:.:.:.
  Fly   321 FYFSVLEDTLKKVGY-KGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIVAVKANTFKIHELIQDP 384

  Fly   381 DNGDGLKLAMYSNARYKKHVSAILKWLNNRGAF 413
            :    ::...|....|.:.|..:|......|.|
  Fly   385 E----IRQKSYLYDPYVQDVKKLLGKYEEMGYF 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 66/305 (22%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 66/305 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55431
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.