DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG10514

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster

Alignment Length:429 Identity:93/430 (22%)
Similarity:184/430 (43%) Gaps:44/430 (10%)


  Fly     8 APMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVEL--QDHTIENV 70
            |..|.||.....|..|...|......|...:....|.|||||..::.|.::|..|  ::..::|:
  Fly     2 AAAPEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNL 66

  Fly    71 SYMLKTPY-DFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYV 134
              ::||.. |.|:.:|::...:::..|..::.:|:|:..::..::|...:....|..:|.....:
  Fly    67 --IVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRERMAI 129

  Fly   135 LLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESI 199
            :.:||..:|:...||:..|:..||..:|:|:|::||.:|                    .:.|..
  Fly   130 IFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATA--------------------VLNERQ 174

  Fly   200 EQVAETLGK-YFLKCLPLYEGY------------------EEYSAAVHKMQPKIVDLMYAMNTPD 245
            ....|:..: :|.:....|.||                  ..|...:..:.|..:|:......|.
  Fly   175 SGCLESYDRGFFNRYTNAYSGYFVGGLLAAARWMSKVPTLAHYGEKLFALAPHYMDIGRECFAPT 239

  Fly   246 PQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQF 310
            |...|.|.|||.||:|:||||:..:..|::...:|.|.....|...||.:....|.|..::..|.
  Fly   240 PGQVNVLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQ 304

  Fly   311 DYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTD 375
            :...::||....|.|..|||.:.:.|:|.....::.:......|...::.|.::.....||....
  Fly   305 NGLFQFYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPTDACFNA 369

  Fly   376 FVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRGAFQ 414
            .:.:.:.|...|..:|:|...::::.:::.:.:.:|..:
  Fly   370 LMNDDERGIRFKNRLYNNPTVQQNLHSLVPFFDRKGLLE 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 72/307 (23%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 72/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55744
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.