DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG11878

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651369.1 Gene:CG11878 / 43050 FlyBaseID:FBgn0039310 Length:420 Species:Drosophila melanogaster

Alignment Length:420 Identity:103/421 (24%)
Similarity:191/421 (45%) Gaps:32/421 (8%)


  Fly     9 PMPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQ-DHTIENVSY 72
            |.|.||.:...::.|...:..:...:.:...:..:..|.||.::|.|:.:|...: ....::.::
  Fly    11 PAPVWLTSEYVQDKLRTYFKDSSLKLATLDTKPAVANGGNYGSVMTRINVEYTTKVSKGKQSTTF 75

  Fly    73 MLKTPY-DFEMYREILRKNNMFAVERDVFIQVIPELEQMY-KDVGVEVKFGAKAYEIDAPDDYVL 135
            ::||.: |.:...::|....::..|.|::..::|:|..|. |::....|..|....:|...|.::
  Fly    76 LVKTTFADRDPAGDVLIHYGVYTREMDIYEHILPQLADMVRKELKDSRKLFAATMNVDRERDSII 140

  Fly   136 LQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLK-GPYPQNYLQ-------PTYA 192
            .:|:....::...|.:.||:.||..||:|:|.:||.|:.....: |.:.:||.:       ..||
  Fly   141 FEDMSLDHYKVACRRKKLDLEHTHLVLEKLALFHAASSVLAERQPGIFDKNYDRGFFNKHTRAYA 205

  Fly   193 DTMKESIEQVA------ETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNA 251
            ..|...:|.::      |.||             :.|.|.:.::..:::|......|..|.||..
  Fly   206 PIMTNLLEALSRSLASDEELG-------------QRYKAKIDRLVERLMDYGERSTTSSPGDFLT 257

  Fly   252 LNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKY 316
            |.|||.||:|.||:| |....|....|:|.|.....|.|.||.||...|.:..::|......:::
  Fly   258 LAHGDLWTTNFMFQY-DAKEHPTNAIFIDFQFSVWNSPAIDLHYFFSTSLQDNLRLEHQTELVQF 321

  Fly   317 YHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETD 381
            |:..|.|.||.|.| ..:.|:|.....|....|......:.|..|.:..:..|||::...::.::
  Fly   322 YYYRLTEALRKLKY-AGRIPSLFDFQLQFRSRGFYAVFCSLIFEPVMQYEGKEDASIEQVLSSSE 385

  Fly   382 NGDGLKLAMYSNARYKKHVSAILKWLNNRG 411
            :|...|.::|.:...||.:|..|.:|:..|
  Fly   386 SGMRFKNSVYESENIKKKLSVTLPFLDQFG 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 79/302 (26%)
CG11878NP_651369.1 EcKinase 47..335 CDD:281023 79/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55735
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.