DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG9259

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster

Alignment Length:405 Identity:94/406 (23%)
Similarity:162/406 (40%) Gaps:44/406 (11%)


  Fly    11 PTWLRA---NLFEELLSKRYGG----NYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIE 68
            ||.:|.   ..|.:.:|....|    ||    :.||.:....|...|.:.|.:.|::...:...:
  Fly     9 PTEIRGLCQRYFHQDVSNSDTGFDIVNY----TLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQ 69

  Fly    69 NVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDY 133
            ...:....|...|...|.|....:|..|..|:..|:|:|.:...:|      ..|.|..|  .:.
  Fly    70 LTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHKACAEV------APKCYYAD--KNL 126

  Fly   134 VLLQDLGPLGFRNVDRLEGL---DMVHTKCVLKKMAQWHAVSATRIHLKG-----PYPQNYLQPT 190
            ::.::|...|:|.....:||   :.:|  |.||.:|..||.|..:....|     ..|::.::..
  Fly   127 LIFENLADQGYRMGAGRDGLLTYEQLH--CCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENA 189

  Fly   191 Y-ADTMKESIEQV----AETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFN 250
            | :|...|.:..|    |..:.|.|:|.:|.|:...:|  .:.....|:..:..|:.|.|... |
  Fly   190 YPSDVSPEHMRMVNFQNACLVLKEFIKLIPKYQSKLDY--VLENFTEKMSFIFEAVKTSDVYQ-N 251

  Fly   251 ALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIK 315
            .:.|||.|.:||||:|......|::...||.||.:......|::..|...|..|.:.:.....:.
  Fly   252 TILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLA 316

  Fly   316 YYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTET 380
            .|:..:.|.|:..:...|:.......:..:.|:..||...:.:.|..|:|.......||..|   
  Fly   317 EYYRFMTEFLKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLTSSV--- 378

  Fly   381 DNGDGLKLAMYSNAR 395
               ||.. ..::|.|
  Fly   379 ---DGFN-DFFTNKR 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 70/298 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 67/284 (24%)
APH <252..325 CDD:279908 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55272
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.