DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG31974

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster

Alignment Length:413 Identity:99/414 (24%)
Similarity:180/414 (43%) Gaps:58/414 (14%)


  Fly     6 GTAP----MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHT 66
            |..|    :|..:..:|.|......|..:|.          .|||:||.:|||.::.::...|..
  Fly     2 GEVPKIKNLPQVIEPHLPEGCTLDSYSTSYL----------TKPGDNYGSIMLSVQAKIRSADGG 56

  Fly    67 IENVSYMLK-TPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGV-------------- 116
            |.::..:.| .|...::|.:|.:.......|..|:..:.|||:::..:.|:              
  Fly    57 IRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYG 121

  Fly   117 -EVKFGAKAYEIDAPDDYVLLQD-LGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLK 179
             .|....:|.::|.  |.||:|: :...|:|..:|....::..|..:|..:||:||:... :.||
  Fly   122 SRVSLDNRATKVDR--DAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIA-LRLK 183

  Fly   180 GPYP-QNYLQPTYAD-TMKESIEQV-AETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAM 241
            .|.. :.|::|.:.. .|..:|:|. .|.:.|..||.:.|....|.   .|:::: :::|:..|.
  Fly   184 KPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDER---DVNRVK-ELLDIFQAF 244

  Fly   242 ---NTPDPQDFNALNHGDCWTSNIMFKY--EDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGST 301
               |..|...|..|.|||.|.:|:|.||  ..|...|::...||.|:.:..|:.:|:|:.|..|.
  Fly   245 QASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSV 309

  Fly   302 KFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHI----AFILCPP 362
            ...:....|..|:..|::..::.||.:|     ..|..:.:...|:..:...|:    |..:...
  Fly   310 DVNVLEDNFYNFLTIYYNAFIQTLRSVN-----VDTSNYTYELFLEEVQQTAHVQLPHAIFMMKV 369

  Fly   363 VLLDRT---EDANLTDFVTETDN 382
            :|.|.:   :|....||...|.|
  Fly   370 ILADNSTIPKDYKDVDFSVLTKN 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 80/310 (26%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 79/309 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59294
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4024
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.