DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG7135

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster

Alignment Length:386 Identity:94/387 (24%)
Similarity:171/387 (44%) Gaps:31/387 (8%)


  Fly    46 GENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQ- 109
            ||||.:.:.|.:::....:......|.::|:..|.:  :.||.:.:::..|...::.:.|:||. 
  Fly    44 GENYCSNIYRAQIKYRNAESCAMETSLIVKSMPDEK--QAILARLHIYNKETLFYMHIKPKLEAL 106

  Fly   110 MYKDVGVEVKFGA------KAYEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQW 168
            |::.|.   .|.|      ..|....|:..::|:||...|::...|..|||..|...|:.|:|::
  Fly   107 MWRAVD---SFSAWTLAPKHYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEY 168

  Fly   169 HAVSATRIH-----LKGPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLY---EGYEEYSA 225
            ||::.....     :...||...|   :.|.:..  |......|...||...|.   ||:...:.
  Fly   169 HALTMVMAEREPETIVDRYPFGLL---HMDAINS--EPFKLLFGTQLLKLAALVGDCEGFGGITT 228

  Fly   226 AVHKMQPKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVA 290
            .:::......:.:.....|...:.|.|||||.|.:||.|||:.|.... :...:|.||....|:.
  Fly   229 KLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQ-QVKIIDFQLCFYGSLG 292

  Fly   291 YDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHI 355
            :|:.|||..|.:.|:...:....:..|:..||:.|:.|.:.: :.|:...:..::.|....|:.:
  Fly   293 FDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSK-ELPSYEDIMDEIRKREAYGFFV 356

  Fly   356 AFILCP---PVLLDRTEDANLTDFVTETDNGDGLKLAMYSNARYKKHVSAILKWLNNRGAF 413
            ||...|   .:.:| :||.:|.:|..||.....::|....|.|..:.:...||.|:....|
  Fly   357 AFGFFPLMSMIGVD-SEDNSLKNFHDETFARQKVQLMFEGNTRTLESLKCTLKRLDELKLF 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 74/299 (25%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 73/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55152
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.