DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and CG33301

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster

Alignment Length:420 Identity:110/421 (26%)
Similarity:209/421 (50%) Gaps:31/421 (7%)


  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSF--KPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSY 72
            :||||.|...:..|......:...:...  ||..|  .|||:..:|.|:.::.:|.|.::.|.:|
  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATG--KGENFVGVMTRIYVDYQLGDGSVVNKTY 64

  Fly    73 MLKTPYDFEM-YREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYVLL 136
            ::|.....|: ..|:..:..::..|.|::..::|:|:::.::.|::.|..|.|..:|...:.::|
  Fly    65 IVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMIL 129

  Fly   137 QDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTM---KES 198
            :||.|..|.|.||::.|||.||:..|:.:|::||.|   |.|:..:|....:..|....   |::
  Fly   130 EDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAAS---IVLQERHPNLLTKCFYTHFFSRDKKA 191

  Fly   199 IEQVAETLGKYFLKCLPLYEGY----EEYSAAVHKMQPKIVDLMYAMNTPD--PQDFNALNHGDC 257
            ...|...|.|.||:.:   :|.    |.|...:||::..|::  |.....|  ..|...||||||
  Fly   192 YSVVFAGLFKAFLRFI---DGQPNLKEAYGDKLHKLRTHIME--YGARAYDVGESDLKTLNHGDC 251

  Fly   258 WTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLV 322
            ||:||||:| |::.||.....:|.|....||...||.||...|.:.|:...:.: .:::::..|.
  Fly   252 WTTNIMFQY-DDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHHYKALK 314

  Fly   323 EHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYH--IAFILCPPVLLDRTED-ANLTDFVTETDNGD 384
            .:|...:| :...||   |....|::.|..:.  :|.:..|.::.:.:|: ::.:....|:..|.
  Fly   315 ANLEKFSY-KGSLPT---LQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEGL 375

  Fly   385 GLKLAMYSNARYKKHVSAILKWLNNRGAFQ 414
            ..:.::|::....:..:.:|..|:.:|..:
  Fly   376 RYQKSVYASEAVIRSATKLLAILDAKGLLE 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 86/295 (29%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 86/295 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55746
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.