DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and C18B10.6

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_504924.1 Gene:C18B10.6 / 182773 WormBaseID:WBGene00015963 Length:436 Species:Caenorhabditis elegans

Alignment Length:331 Identity:64/332 (19%)
Similarity:127/332 (38%) Gaps:79/332 (24%)


  Fly    30 NYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEM----------YR 84
            |.:.:|.|..:..|              :|.:.|     ||...|:.|:.|.:          :.
 Worm    60 NISDLKGFMSKIAL--------------IEADWQ-----NVEENLQLPHKFAVKISSQLPYIAFS 105

  Fly    85 EILRKNN-----------MFAVERDVF---IQVIPELEQM-YKDVGVEVKFGAKA-YEIDAPDDY 133
            ::|:..:           :..:.||..   |:....||:. :.::.....:|.|. |:.:....|
 Worm   106 KVLKYTDENGYEDEKLKYLAKILRDAHNREIETYKLLEKFNHANIPYTKIYGLKPFYDENDLKGY 170

  Fly   134 VLLQDLGPLGFRNV-DRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQ-------NYLQPT 190
            ::|:.:..:...:: :.:...|::.|   ::.:|.:.|:.|..     |..|       |:|: .
 Worm   171 IILEYIPNIHTTSMSENIPADDLIST---IRAVATFGALGACL-----PADQKTFALGANFLE-Y 226

  Fly   191 YADTM--KESIEQVAETLGKYFLKC-----LPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQD 248
            |.||.  ...:|.:.:.|.|....|     ..|.:.|..|...|.|.. ||.:::.....|    
 Worm   227 YYDTFLGAAGVESILDNLRKSLSFCETSKVEKLIDIYRHYIKIVSKFS-KIDEILGFHLVP---- 286

  Fly   249 FNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYF 313
                ||||.|.||::|..|:.....::. .:|.|........:|::...:|:...|.:..:...|
 Worm   287 ----NHGDLWQSNMLFNTEESGHLKLKA-LIDWQAVANLPPGFDMVRLFIGALSIEDRRQRASEF 346

  Fly   314 IKYYHD 319
            :|.||:
 Worm   347 LKIYHE 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 60/317 (19%)
C18B10.6NP_504924.1 DUF1679 21..427 CDD:285194 64/332 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.