DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and C29F7.2

DIOPT Version :8

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans

Alignment Length:450 Identity:86/450 (19%)
Similarity:152/450 (34%) Gaps:132/450 (29%)


  Fly    13 WLRANLFEELLSKRYGGNYAGIKSFKPEAG----LKPGE-NYSTIMLRLKLEVE---------LQ 63
            ||     .|::.|:.|        .||:.|    |...| .|.:::.:::|..:         |.
 Worm    15 WL-----AEIIEKKIG--------VKPKIGTSGILDNSELGYMSMIRKVQLHFDAEHEESHPNLP 66

  Fly    64 DHTIENVSYMLK------------TPYDFEMYREILRKN------NMFA--VERDVFIQVIPELE 108
            .|.:..::...|            |..|.....|:...|      .:||  .|:.:.:.||    
 Worm    67 KHVVLKIACSSKGTGVLDSAGADMTETDHSANVELFMHNTECNYYKIFAKLTEKPLHLPVI---- 127

  Fly   109 QMYKDVGVEVKFGAKAYEIDAPDDYVLLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSA 173
              |..:        ||.:.:||...::::.....  :..|.:.|.:......::.::.:.|..|.
 Worm   128 --YAAI--------KAEDKEAPVPVIVMEMFEDC--KVYDIITGFNEEQLYKIVDEIVKLHIFSL 180

  Fly   174 TRIHLKGPYPQNYL--QPTYADTMKESI-EQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIV 235
            |....|...|..::  ...|..||...| |::|:..|      |.|...|.:.:.|.   .||  
 Worm   181 TTEEWKTIVPDAFVLEMAGYFQTMVAGIGEKLAQQPG------LELVSTYIKNTFAT---DPK-- 234

  Fly   236 DLMYAMNTPD----PQDFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYF 296
               :..|..|    .:..:.|.|||.|...|::...|:.     ...:|.|:....|...|..:.
 Worm   235 ---FLQNINDEYLEERRISVLTHGDLWAPQILWDKNDDI-----AGIIDWQITHRGSPMEDFHHI 291

  Fly   297 LLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCP 361
            :...|..|.:.:.....:.||.|.|...|      |||...:.:...::    ...|..:||   
 Worm   292 MSTCTSVENRKNLTKPLLDYYFDKLSSGL------EAKGVKMPWTREEI----EEEYKYSFI--- 343

  Fly   362 PVLLDRTEDANLTDF---------VTETDN-------GDGLKLAMYSNARYKKHVSAILK 405
                   ..|.||.|         |.:||.       |:..|       |.|.::..:::
 Worm   344 -------NGAALTIFANGFWANSPVLQTDGKPDPVRIGESFK-------RCKSYLEEVIQ 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 60/322 (19%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 40/206 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.