DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10559 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:305 Identity:57/305 - (18%)
Similarity:109/305 - (35%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDDYVLLQDLGPLGFRNV 147
            :.:..:|.:...||   |.:....||.:.    :...|.::.:|.|.|:.          ||..:
 Worm   113 FEKSCQKGHNLEVE---FCEAFGHLEGLL----LPKVFFSQKFEEDNPNK----------GFVGM 160

  Fly   148 DRLEGLDMVHTKC-----------VLKKMAQWHAVS----------------------ATRIHLK 179
            :.:||..:.|  |           :||.:|:..|:|                      .:...||
 Worm   161 EFVEGSVVRH--CYENVTVDELQPILKALARLQALSLSTESCRNLDNGEAFEESLMDMLSEDGLK 223

  Fly   180 GPYPQNYLQPTYADTMKESIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTP 244
            |.:.|:   ......:.|.:|::.:.                      ||   :|::|...:|..
 Worm   224 GIFDQS---RNIDQKLSEKVERIEQN----------------------HK---EILNLETVLNLN 260

  Fly   245 DPQ--DFNALNHGDCWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQL 307
            ...  |...:.|||.|.:||::...|..  .|....:|.|...:.:.|.||:..|:.:.....:.
 Worm   261 KVVGIDQKVICHGDLWAANILWTQTDGG--FIADKVLDYQESHMGNPAEDLVRLLVSTISGADRQ 323

  Fly   308 SQFDYFIKYYHDHLVEHLRMLNYPEAKTPTLGFLHTQLLKYGRVG 352
            |.:::.::.::.:..:.:...|.|.    ||..|.|....|..||
 Worm   324 SHWEHILEQFYTYFTDEIGSNNAPY----TLEQLKTSFKLYFPVG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 48/281 (17%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 57/305 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.