DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11893 and CG33301

DIOPT Version :8

Sequence 1:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster

Alignment Length:418 Identity:118/419 (28%)
Similarity:182/419 (43%) Gaps:42/419 (10%)


  Fly    18 PAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFC-KPLIIK 81
            |.||.|.::...||.|.:...|:|..:...||:.:|:::..||.|...:|....|... |..|:|
  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIVK 67

  Fly    82 TMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEPRQVLIFED 146
            .....|..:.::..:..|::.|::.|...||:.:.:|:|||.|.||....|....| ...:|.||
  Fly    68 QALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDRE-YNTMILED 131

  Fly   147 LVPQGYFVIRDR--PINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFKYGLMEMPSIMSDPMV 209
            |.|. .||..||  .::|...:.....|||:||.|:.:....|::|....|.........:..:|
  Fly   132 LAPY-KFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCFYTHFFSRDKKAYSVV 195

  Fly   210 TTGM-DNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDG---YYV-------M 263
            ..|: ..||:.:|..|.|          ||.|    ||.:.:.|.::...|   |.|       :
  Fly   196 FAGLFKAFLRFIDGQPNL----------KEAY----GDKLHKLRTHIMEYGARAYDVGESDLKTL 246

  Fly   264 CHGDFHGRNMMFNKNE-----EVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLINFYF 323
            .|||....|:||..::     .|:.:|||..|....||||.| .:.....|:..|...:|:..::
  Fly   247 NHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHY-FFTTSLREEVGDKESELVEHHY 310

  Fly   324 SVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSP-MIVAVKANTFKIHEL-IQDPE- 385
            ..|:..|:|..|||.:||......|..|.:|.. .|...|.| ||......|.....| .:.|| 
  Fly   311 KALKANLEKFSYKGSLPTLQEYRLQFERRRFMS-LLAHMFKPCMIYNGSEETSDFSSLYAESPEG 374

  Fly   386 IR-QKS-YLYDPYVQDVKKLLGKYEEMG 411
            :| ||| |..:..::...|||...:..|
  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKG 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 81/302 (27%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 81/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63119
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.